KEGG   Streptomyces coelicolor: SCO2508Help
Entry
SCO2508           CDS       T00085                                 

Gene name
SCC121.11
Definition
(RefSeq) metal uptake regulation protein
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sco03000]
    SCO2508 (SCC121.11)
Transcription factors [BR:sco03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    SCO2508 (SCC121.11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR TrmB Nudix_N_2 HTH_32 S8_pro-domain
Motif
Other DBs
NCBI-GeneID: 1097942
NCBI-ProteinID: NP_626748
Kitasato: SCO2508
UniProt: Q9L2H5
Structure
PDB: 

Position
2706801..2707220
Genome map
AA seq 139 aa AA seqDB search
MTTAGPPVKGRATRQRAAVSAALQEVEEFRSAQELHDMLKHKGDAVGLTTVYRTLQSLAD
AGEVDVLRTAEGESVYRRCSTGDHHHHLVCRACGKAVEVEGPAVEKWAEAIAAEHGYVNV
AHTVEIFGTCADCAGASGG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgctggaccgcccgtgaagggccgcgccacccggcagcgggctgccgtgtcg
gccgcccttcaggaggtcgaggagttccgcagcgcgcaggagctccacgacatgctcaag
cacaagggcgacgcggtcgggctcaccacggtctaccgcacccttcagtccctcgccgac
gccggtgaggtcgacgtcctgcgcaccgccgagggcgagtccgtctaccggcgctgctcc
accggcgaccatcaccaccacctggtctgccgcgcctgcggcaaggcggtcgaggtggag
ggccccgccgtcgagaagtgggccgaggccatcgccgccgagcacggctacgtcaacgtg
gcgcacacggtggagatcttcggcacctgcgccgactgcgcgggggcctccggcggttga

DBGET integrated database retrieval system