KEGG   Streptomyces coelicolor: SCO2554
Entry
SCO2554           CDS       T00085                                 

Gene name
dnaJ2
Definition
(RefSeq) chaperone protein DnaJ
  KO
K03686  molecular chaperone DnaJ
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sco03110]
    SCO2554 (dnaJ2)
   03029 Mitochondrial biogenesis [BR:sco03029]
    SCO2554 (dnaJ2)
Chaperones and folding catalysts [BR:sco03110]
 Heat shock proteins
  HSP40 / DNAJ
   SCO2554 (dnaJ2)
Mitochondrial biogenesis [BR:sco03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    SCO2554 (dnaJ2)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP
Other DBs
NCBI-GeneID: 1097988
NCBI-ProteinID: NP_626792
Kitasato: SCO2554
UniProt: Q9RDD7
Position
complement(2753870..2755006)
AA seq 378 aa
MATDYYAVLGVRRDASQDEIKKAFRRLARELHPDVNPDPKTQERFKEINAAYEVLSDPQK
KQVYDLGGDPLSQAAGGGAGGFGAGGFGNFSDIMDAFFGTASQRGPRSRTRRGQDAMIRI
EVELDEAAFGTTKDIQVDTAVVCNTCNGEGAAPGTSAQTCDMCRGRGEVSQVTRSFLGQV
MTSRPCPQCQGFGTVVPTPCPECAGDGRVRSRRTLTVKIPAGVDNGTRIQLAGEGEVGPG
GGPAGDLYVEIHELPHSTFQRRGDDLHCTVTIPMTAAALGTKVPLETLDGMEEVDIRPGT
QSGQSIPKHGRGVTHLRGGGRGDLIVHVEVTTPGKLDPEQERLLRELAKLRGEERPTGQF
QPGQQGLFSRLKDAFNGR
NT seq 1137 nt   +upstreamnt  +downstreamnt
gtggccacggactactacgccgtactcggcgtgcgccgcgacgcctcccaggacgagatc
aagaaggcgttccggaggctcgcgcgcgagctgcatccggacgtcaaccccgatccgaag
acccaggagcggttcaaggagatcaacgccgcctacgaggtgttgtcggacccgcagaag
aagcaggtctacgacctcggcggcgaccccctctcgcaggccgccggcggtggcgcgggc
ggcttcggcgcgggtggcttcgggaacttctcggacatcatggacgcgttcttcggcacg
gcgtcgcagcgcgggccgcgctcgcgcacccgccgcggccaggacgcgatgatccgcatc
gaggtcgagctggacgaggccgccttcggtacgaccaaggacatccaggtcgacaccgcg
gtcgtctgcaacacctgcaacggcgagggcgcggcgccgggcacgtcggcccagacgtgt
gacatgtgccgcggtcgaggcgaggtctcgcaggtcacccggtccttcctgggccaggtc
atgacctcgcgcccctgcccgcagtgccagggcttcggcaccgtggtcccgaccccgtgc
cccgagtgcgcgggcgacggccgggtccgctcccggcgcaccctgaccgtgaagatcccg
gccggtgtcgacaacggcacccggatccagctcgcgggcgagggcgaggtcggccccggc
ggcggccccgccggcgacctgtacgtcgagatccacgagctgccccactccaccttccag
cggcgcggcgacgacctgcactgcacggtcaccatcccgatgacggcggcggccctcggc
accaaggtgccgctggagaccctcgacggcatggaggaggtcgacatccgcccgggcacc
cagtccggccagtcgatcccgaagcacggccggggcgtcacccacctgcgcggcggcggt
cgcggcgacctcatcgtgcacgtcgaggtcaccaccccgggcaagctcgaccccgaacag
gaacgcctcctgcgcgagctggccaagctccgcggcgaggaacgcccgacggggcagttc
cagccggggcagcaagggctgttctcgcggctgaaggacgccttcaacgggcgctga

DBGET integrated database retrieval system