KEGG   Streptomyces coelicolor: SCO2737Help
Entry
SCO2737           CDS       T00085                                 

Gene name
SCC57A.08c
Definition
(RefSeq) deoxyribonuclease
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sco  Streptomyces coelicolor
Pathway
sco03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SCO2737 (SCC57A.08c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SCO2737 (SCC57A.08c)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SCO2737 (SCC57A.08c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 Helicase_RecD AAA_22 PIF1 AAA_16 PhoH UvrD_C TrwB_AAD_bind DEAD HTH_IclR NACHT AAA ABC_tran AAA_10 HHH_2
Motif
Other DBs
NCBI-GeneID: 1098171
NCBI-ProteinID: NP_626969
Kitasato: SCO2737
UniProt: Q9RDI9
Position
complement(2984296..2986557)
Genome map
AA seq 753 aa AA seqDB search
MPTQPPAAPGERRLATLEGVLERVTYANEENGYTVARVDTGRGAGDLLTVVGALLGAQVG
ESLRMEGRWGSHPQYGKQFHVENYTTLLPATVQGIRRYLGSGLVKGIGPIFADRITQHFG
LDTLTIIEEEPKRLIEVPGLGPKRTKKIADAWEEQKAIKEVMLFLQTVEVSTSIAVRIYK
KYGDASISVVKNQPYRLAADVWGIGFLTADKIAQSVGIPHDSPERVKAGLQYALSQATDQ
GHCYLPEEKLIADAVKLLQVDTGLVIECLGELAAEPEDPDGDPGVVREKVPHSEGGEPVT
AVYLVPFHRAELALAGQLRRLLHTDEDRMPGFRDVAWDNALGWLKRRTGADLAPEQEEAV
KLALSEKVAVLTGGPGCGKSFTVRSIVELARAKKAKVVLAAPTGRAAKRLAELTGAEAST
VHRLLELKPGGDAAYDRERPLDADLVVVDEASMLDLLLANKLAKAVPPGAHLLLVGDVDQ
LPSVGAGEVLRDLLAPGSPVPAVRLTRVFRQAQQSGVVTNAHRINAGQHPLTDGMKDFFL
FVEDDTEEAGRLTVDVAARRIPAKFGLDPRRDVQVLAPMHRGPAGAGTLNGLLQQAVTPG
RPDVPEKRFGGRVFRVGDKVTQIRNNYEKGENGVFNGTVGVVTSLDPVDQRLTVLTDEDE
EVPYDFDELDELAHAYAVTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVTRAKRLVV
LVGSRKAIGQAVRTVSAGRRCTALDFRLAGPRT
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccagccccccgcggcccccggcgagcggcggctcgccaccctcgaaggcgtc
ctggagcgtgtcacgtacgccaacgaggagaacggctacaccgtcgcccgcgtcgacacc
ggcagaggcgccggcgatctgctgaccgtcgtcggcgcgctgctcggcgcgcaggtgggg
gagtcgctgcggatggaggggcgctgggggtcgcacccccagtacggcaagcagttccac
gtggagaactacacgacgctgctccccgccaccgtgcagggcatccggcgctatctgggg
tccgggctggtcaagggcatcgggccgatcttcgccgaccggatcacgcagcacttcggg
ctggacaccctcacgatcatcgaggaggagcccaagcggctcatcgaggtgcccggcctc
gggcccaagcggaccaagaagatcgccgacgcctgggaggagcagaaggcgatcaaggag
gtcatgctcttcctccagaccgtcgaggtgtccacctccatcgcggtgcggatctacaag
aagtacggggacgcatcgatctccgtcgtgaagaaccagccctaccggctcgccgccgat
gtgtggggcatcggcttcctcaccgccgacaagatcgcccagtccgtagggatcccgcac
gacagcccggagcgggtgaaggccggcctgcagtacgcgctgtcccaggccaccgaccag
gggcactgctacctccccgaggagaagctgatcgccgacgcggtgaagctgctccaggtg
gacaccgggctcgtcatcgagtgcctcggggagctggccgccgagcccgaggacccggac
ggcgaccccggggtcgtgcgggagaaggtgccccattccgagggcggcgagcccgtcacc
gccgtctacctcgtgcccttccaccgggccgagctggccctggcggggcagttgcggcgc
ctcctccacaccgacgaggaccggatgcccggcttccgggacgtggcctgggacaacgcg
ctcgggtggctgaagcggcgcactggcgccgacctcgcgcccgagcaggaggaggccgtc
aagctcgcgctcagcgagaaggtcgccgtgctcaccggcgggcccggctgcggcaagtcc
ttcaccgtgcggtccatcgtggagctggcgcgggccaagaaggcgaaggtcgtactggcc
gcgcccaccggccgggccgccaagcggctcgccgagctgaccggcgccgaggcgtccacc
gtgcaccgcctgctggagctgaagcccggcggtgacgccgcctacgaccgggagcggccg
ctcgacgcggacctggtggtggtggacgaggcgtcgatgctcgatctgctcctcgccaac
aagctcgcgaaagccgtcccgcccggcgcccacctgctgctcgtcggcgatgtcgaccag
ttgcccagcgtgggggcgggggaggtgctccgggacctgctggccccgggcagccccgtg
ccggccgtccgtctcacccgcgtcttccggcaggcccagcagtccggcgtcgtcaccaac
gcgcaccggatcaacgccgggcagcacccgctcaccgacgggatgaaggacttcttcctc
ttcgtcgaggacgacaccgaggaggccgggcggctcacggtggacgtcgccgcgcggcgc
atccccgcgaagttcgggctcgacccgcgccgggacgtgcaggtgctggcgccgatgcac
cggggacccgccggtgccgggacgttgaacgggctgctccagcaggccgtcaccccgggg
cgcccggacgtgcccgagaagcggttcggcggacgggtcttccgggtcggcgacaaggtc
acccagatccgcaacaattacgagaagggcgagaacggcgtcttcaacggcaccgtgggc
gtcgtcacctcgctcgacccggtcgaccagcgcctcaccgtgctgacggacgaggacgag
gaggtgccgtacgacttcgacgaactcgatgaactggcccacgcgtacgcggtcaccatc
caccggtcccaggggagcgagtacccggccgtcgtgatccccgtgacgaccggggcctgg
atgatgctccagcggaatctgctgtacacggcggtcacccgggcgaaacggctggtcgtc
ctcgtcgggtcgcgcaaggcgatcgggcaggcggtgcggacggtgtcggccgggaggcgg
tgcacggcgctcgacttccggttggcggggccccggacctga

DBGET integrated database retrieval system