KEGG   Streptomyces coelicolor: SCO2812
Entry
SCO2812           CDS       T00085                                 

Symbol
SCBAC17F8.03
Name
(RefSeq) drug efflux protein
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Other DBs
NCBI-GeneID: 1098246
Kitasato: SCO2812
UniProt: Q93J85
Position
3070648..3071898
AA seq 416 aa
MRELSQGRRPQSWSYPALLVLLMLGQATSAIPSPLYSLYAEKWDYPPVLTTVVFAAYGAV
AVVAILLSGALSDRYGRRPVLLVAVLLLLAGLAVFVFAAGPAYLVVARMLNGLGIGAIVV
VGGAALLDVRPERAARSGTLTAIAFNIGIAAAALGTAALAQTGFHPLLLPYLTDALIGLV
LLVLLLVMREPHPSPGTATVGIPRPHVPKEMRGRFTFSVLGAGAAWAVLGVCFSLEPSIA
ADAANVDGPFFGGVVIAAVTLAAACTQILSARRPARTVALVGDTALAVLMLAGVGAFATG
NAVVIVVAVALQGGAYGLAFGGSLRHLTAGIPAERRGAVMSMFYLLAYGALVTPTLLVGV
GATVWADTTVFFVFSVLTALLCFSAVVVERVRERRRRPAEAVPAPGTDVREASTAD
NT seq 1251 nt   +upstreamnt  +downstreamnt
gtgcgggaactctcccagggccgccgcccccagtcatggagctatccggccctcctcgtc
ctcctcatgctcgggcaggcgacctccgccatcccctcaccgctctactccctgtacgcc
gagaagtgggactaccctcccgttctcaccaccgtcgtcttcgccgcctacggggccgtc
gcggtcgtcgcgatcctcctgtccggcgccctctccgaccggtacggccgccggcccgtg
ctcctcgtcgccgtcctgctgctgctcgccgggctcgccgtcttcgtgttcgccgcagga
cccgcgtacctcgtcgtggcccggatgctcaacggactgggcatcggcgcgatcgtcgtg
gtcggcggagccgccctgctggacgtgcgccccgagcgggcggcacgcagcgggacgctg
accgccatcgcgttcaacatcggtatcgccgccgccgcactcggcaccgcggccctcgcc
cagaccggcttccaccccttgctcctgccgtacctcaccgacgcgctgatcggcctcgtc
ctgctggtcctcctcctggtgatgcgcgaaccgcacccgtcccccggtacggcgaccgtg
gggatcccacgcccgcacgtgcccaaggagatgcgcggacgcttcaccttctccgtgctc
ggcgccggtgccgcctgggcggtgctcggggtctgcttctcactggagccgtcgatcgcc
gccgacgccgcgaacgtggacggcccgttcttcggcggcgtcgtcatcgcggccgtgacc
ctcgccgccgcctgcacacagatcctcagcgcccgccgtccggcacgcacggtcgcactc
gtcggcgacaccgcgctcgccgtgctcatgctggccggagtaggtgccttcgccaccggc
aacgccgtcgtcatcgtcgtcgccgtcgccctccagggcggcgcctacgggctcgccttc
ggcggctccctgcgccacctcaccgccggcatccccgccgaacggcgcggggccgtcatg
tcgatgttctacctgctcgcgtacggcgccctcgtcacgcccaccctcctcgtcggcgtc
ggcgcgaccgtctgggccgacaccacggtcttcttcgtcttctccgtgctcacggcgctg
ctctgcttctccgccgtggtcgtcgagcgggtaagggaacgccggcgccggcccgccgag
gccgtaccggcgccgggaacggacgtacgggaggcgagcaccgccgactga

DBGET integrated database retrieval system