KEGG   Streptomyces coelicolor: SCO3251Help
Entry
SCO3251           CDS       T00085                                 

Gene name
SCE29.20c, SCE39.01c
Definition
(RefSeq) excisionase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17 Phage_AlpA TrmB HTH_23
Motif
Other DBs
NCBI-GeneID: 1098685
NCBI-ProteinID: NP_627463
Kitasato: SCO3251
UniProt: Q9Z4Y0
Position
complement(3603907..3604107)
Genome map
AA seq 66 aa AA seqDB search
MTAATAVATAELLTVPEVMARLKVGRSKVYDLIRSRRLVSIKIDGARRIPAAAVRDFVLG
QIEEAA
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgccacggcagttgccaccgctgagttgctgaccgtgccggaagtcatggcg
cgtctcaaggtcggacgctcgaaggtctatgacctgatccgctcgcgacgcctcgtctcg
atcaagattgatggggcgcgtcgcatccccgctgccgctgttcgggacttcgtcctcggc
cagatcgaggaggctgcctga

DBGET integrated database retrieval system