KEGG   Streptomyces coelicolor: SCO3253Help
Entry
SCO3253           CDS       T00085                                 

Gene name
SCE39.03c, spdD
Definition
(RefSeq) SpdD protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_2_4
Motif
Other DBs
NCBI-GeneID: 1098687
NCBI-ProteinID: NP_627465
Kitasato: SCO3253
UniProt: Q9X8C6
Position
complement(3605594..3605911)
Genome map
AA seq 105 aa AA seqDB search
MFRPKIPTNPTPAGHVTPPVVVESTAVVPSVQVPPPAPVAPAPSRPTVQLTPGTALALVG
GGTAVVLVVGAVLVSLLLAVAITGASVAVCALVIRSLVQADAKRR
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcccgaagatcccgaccaatcccacgcccgctggccacgtcacgccgcccgtg
gtcgtggagtcgaccgccgtcgtgccgagcgtgcaggttccgccgcctgctccggtcgct
ccggcaccgtcccggcccacggtgcagctcacccccggcaccgccctcgccctcgttggc
ggtgggacggccgtcgtcctggtcgtcggcgcagttctcgtctcgctgctcctggccgtc
gccatcaccggtgcctcggtcgctgtctgcgccctggtgatccgctccctcgtccaggcc
gacgccaagcgtcgctga

DBGET integrated database retrieval system