KEGG   Streptomyces coelicolor: SCO3259Help
Entry
SCO3259           CDS       T00085                                 

Gene name
korSA, SCE39.09c
Definition
(RefSeq) korSA, regulatory protein
  KO
K03710  GntR family transcriptional regulator
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sco03000]
    SCO3259 (korSA)
Transcription factors [BR:sco03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    SCO3259 (korSA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UTRA GntR HTH_DeoR Rrf2 HTH_41
Motif
Other DBs
NCBI-GeneID: 1098693
NCBI-ProteinID: NP_627471
Kitasato: SCO3259
UniProt: Q9X8D2
Position
complement(3608916..3609695)
Genome map
AA seq 259 aa AA seqDB search
MGTAVEGGRSGPRYVQIADEIVQQIRAGVLKPGDMVPSESELVDRYGVSGGTIRKAMVEV
RASGLVETRHGKGSIVKDRPPVRHRSSDRFRRSLRQGGKAAYLAESAQSGATAKVSVLYI
GPMEAPADAAQRLGLPAGTQVLARRRLYFRNGTPVETASSYLPWDVVKDIPELFAENPGG
GGIYARLEDHGHEFAEFVETLQARPASKAEASELALSPGAPVVHLIREARTTAGVVVEVC
DTLMAADQFVFEYRIPAAD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgcggtagaggggggcaggtccgggcctcggtacgtgcagatcgcggacgag
atcgtgcagcagatccgggcgggtgtgctcaagcccggtgacatggtgccgagtgaatcg
gagctggtggaccgctacggcgtgtccggcggcacgatccgcaaggccatggtcgaggta
cgggcgagcgggctcgttgagacccggcacggcaagggttcgatcgtgaaggaccggccg
ccggtgcggcaccgttcctccgaccgcttccggcgctcgctccgccagggcggcaaggcc
gcgtacctcgcggagtccgcccagtccggcgccactgccaaggtgagcgtcctctacatc
gggcccatggaagcccccgcggatgccgctcagcggctcggcctccccgccggcactcag
gtgcttgcacggcgccgcctctacttccgcaacggcaccccggtcgagaccgcctcctcc
tacctcccgtgggacgtcgtcaaggacatcccggagctgttcgccgagaaccccggcggc
ggtggcatttacgcccgactcgaagaccatgggcacgagttcgcggagttcgtcgagacg
ctgcaagcgcggccggcttcgaaggcagaagcctctgagctggcgctgagtccgggtgcg
ccggtggttcatctgatccgtgaggcccgtacgacggccggagtcgtggtggaggtctgc
gacacgctcatggctgctgaccagttcgttttcgagtaccggatccctgcggccgactga

DBGET integrated database retrieval system