KEGG   Streptomyces coelicolor: SCO3260Help
Entry
SCO3260           CDS       T00085                                 

Gene name
SCE39.10
Definition
(RefSeq) MutT-like protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-GeneID: 1098694
NCBI-ProteinID: NP_627472
Kitasato: SCO3260
UniProt: Q9X8D3
Position
3609789..3610178
Genome map
AA seq 129 aa AA seqDB search
MREDGRLLAIRRADNGTWELPGGVLELNETPEAGVAREVWEETGIHVEVDELTGVYKNTT
RGIVALVFRCKPSGGTERTSSESTAVSWLTPDEVSDRMAEVYAIRLLDALDGNGPHVRSH
DGKHLIPTG
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgaagacggccgcctcctggccatccgccgagccgacaacggcacctgggaactc
cccggaggcgtactcgaactcaacgagaccccagaggccggcgtagcccgcgaagtctgg
gaagagaccggcatccacgtcgaggtcgacgaactcaccggcgtctacaagaacaccacc
cgaggcatcgtcgccctggtcttccgctgcaagccctccggcggcaccgaacgcacctca
agcgagtccacagccgtctcctggctcacacccgacgaggtcagcgaccgcatggccgag
gtctacgcgatcagactcctggacgccctggacggcaacggcccccacgtacgaagccac
gacggcaagcacctcatcccaacgggataa

DBGET integrated database retrieval system