KEGG   Streptomyces coelicolor: SCO3261Help
Entry
SCO3261           CDS       T00085                                 

Gene name
SCE39.11
Definition
(RefSeq) ATP-binding protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_21 AAA_15 SMC_N AAA_23 NACHT ABC_tran
Motif
Other DBs
NCBI-GeneID: 1098695
NCBI-ProteinID: NP_627473
Kitasato: SCO3261
UniProt: Q9X8D4
Position
3610876..3612171
Genome map
AA seq 431 aa AA seqDB search
MVAGRNGAGKTSLLRCIALALAANPETGRALVPSYVMWRSPFDTRTVGKISADLFLDSGD
LSDLNLEGLPEKPGTHARVGITLTPPEEIPKTGRKRSLNLGSEWTQVIECDDDDEEVDQA
IFPTRNWFTAGYGPFRRLSSEIADPRSTRSQLVTPIDPSSVMDRFSTLFHEDATLGEGVS
WLVGLHLRSLENEKGAGRLLQNVLEVLSDGLLPDGYSPVRVSSSGLWVRRQTGKAFPLKE
MSDGFRTVTALVLDIIRQLHTFYGTLRMRRSKKGIAIYAPGVILIDEVDAHLHVGWQQRI
GGWLKSHFPRIQFIVSTHSPYICQSADIGGLIRLPGLNENYPPQVVGEQLYKRIVYGSGD
DAALSDLFGLDTPYGSEAEKLRSKLIEIEGRVLDGSASKAEVRQYREMSETLTSSLSARV
DEVSGRLGRRN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggtagctggccgcaatggcgcgggaaaaacatctctcctgcgctgcattgctttggcc
ctggctgccaaccctgagacgggccgcgcattggtaccgagttacgtcatgtggaggtca
ccttttgacacaaggaccgtagggaagatctcagcagatctctttttggattccggtgat
ctttccgacctaaaccttgaaggtctccccgagaaacccggcacccatgcacgagtaggc
atcacgctgactccacctgaagagatccctaaaacaggccgcaaaagaagcttgaatcta
ggctcggaatggactcaggtaatcgaatgcgacgacgatgacgaggaagtcgaccaggca
atctttccaactagaaattggttcacagcgggatacggccccttccgccgcctttcctcg
gaaattgcagatccgagatctacacgctcacaactggtcaccccaatagatccttcatca
gtgatggatcgcttctctacattgttccacgaggacgccacgctaggggagggtgtttca
tggctcgttggcctacatctgcgcagtctagaaaacgaaaagggagccggccggctcctt
caaaacgtcctggaagtactgtcagatggactactgccagatggctacagccctgttcga
gtatcttcctctggtctatgggtcaggcgccaaacaggtaaagcgtttccgctcaaagaa
atgagtgacgggttcaggaccgtgaccgcgctcgttctcgatataatccgacaactccac
acattctacggcaccctgcgaatgaggagatcaaagaaggggattgcaatttacgctcca
ggcgtgattttgatcgacgaagtcgacgcccatctacacgtggggtggcaacagcgaatt
gggggatggttgaagtctcacttcccaagaatccaattcatcgtctccacacacagccct
tacatctgccaatcagcggacattgggggtttgattcgcctgcccggactgaacgagaac
tatccaccccaagtcgtgggagagcaactctacaagcggatcgtttacggcagcggtgac
gatgctgcactttcagatctattcgggttggatacgccatacggcagcgaggctgagaaa
cttcgcagcaagcttatcgagattgaaggacgagtgctcgacggttcagcaagtaaagca
gaggtaaggcagtacagggagatgagcgagacactcaccagctcgcttagcgcccgcgta
gatgaagtctctggacgtctcgggagaagaaattga

DBGET integrated database retrieval system