KEGG   Streptomyces coelicolor: SCO3262Help
Entry
SCO3262           CDS       T00085                                 

Gene name
SCE39.12
Definition
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNH HNH_4 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 1098696
NCBI-ProteinID: NP_627474
Kitasato: SCO3262
UniProt: Q9X8D5
Position
3612168..3612917
Genome map
AA seq 249 aa AA seqDB search
MIPLKRPGISANLEKRLTGKTKTLTDNLADPKNAREAWKSARTIRRDLKVLLASMAAGFA
RCMYCGDSLGTDIDHFKPIARDPLSAFIWANHFLACSHCNSNKKRDQYPCSPSGECLLVN
PSKEDPYEHMNLNLPTGKYQGQTQKGKETIRVFGLSRPDLELGRAHAYVRCESMLRDWST
RVGNGQEEAASAVLKSLMIQPFADVLYAMIKKSEAPGAPNLFEADVLTALRSVRERIETQ
DVAASFRNP
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgattccactcaagcgtccgggtatctcggcaaacttagagaaaaggttgaccggcaag
accaagactctgaccgataatttggctgacccaaagaatgctcgcgaagcatggaaaagt
gctcggacgatccgcagagacttgaaggtgctacttgccagcatggcggccggatttgcg
cgctgcatgtactgcggagatagcctcgggacagacattgaccatttcaagccgatagcc
cgggacccactttctgcattcatctgggccaaccacttcctcgcctgctctcactgcaac
agcaataagaagcgcgaccagtatccctgcagcccttccggtgaatgcctccttgtgaat
cccagcaaggaagacccttacgagcacatgaatctgaacctccccacggggaaatatcaa
ggacaaacccaaaagggaaaggagactatacgggtattcggcctttctcgacccgacctg
gaacttggccgggcgcacgcgtacgtcagatgcgagtccatgctccgcgactggtcaaca
cgggtaggaaacggtcaggaggaagctgctagtgcagtcctcaagtctcttatgattcaa
ccattcgccgatgtcctttatgccatgattaagaaatctgaagcgccgggggcacctaac
ctctttgaagctgacgtccttacggcgctcaggagtgtgcgagaaaggatcgaaacacag
gacgtagcggcttcctttcgaaatccgtga

DBGET integrated database retrieval system