KEGG   Streptomyces coelicolor: SCO3268Help
Entry
SCO3268           CDS       T00085                                 

Gene name
SCE39.18c
Definition
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1098702
NCBI-ProteinID: NP_627480
Kitasato: SCO3268
UniProt: Q9X8E1
Position
complement(3615122..3615400)
Genome map
AA seq 92 aa AA seqDB search
MPASGVSAAALAARLSALGLPTRVEEHPRHTSVEAEVPDTLSAESWREVLDVVAEADRFG
LLATSLNGRTLWAVVRKAVPSTGDVGGPSHQR
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcttcgggagttagcgcggcggccctcgccgcccggctgtccgccctcggactt
cccacgcgagtggaggaacaccctcggcacacgtcggtggaagcggaggtgccggacacg
ctctccgccgagtcatggcgggaggtcctggacgtggtggctgaagccgaccgcttcggg
ctcctcgccaccagcttgaacggccgcaccttatgggcggtcgtacgcaaagcggtcccc
tcgacgggcgatgtcgggggaccgagccatcagcgatag

DBGET integrated database retrieval system