KEGG   Streptomyces coelicolor: SCO3270Help
Entry
SCO3270           CDS       T00085                                 

Gene name
SCE39.20
Definition
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1098704
NCBI-ProteinID: NP_627482
Kitasato: SCO3270
UniProt: Q9X8E3
Position
3616286..3616798
Genome map
AA seq 170 aa AA seqDB search
MTGDLRFSWELTGSGWATYRIADATSERADIVSYCTDALSDLLRAVVSLYGAADAARVSF
DLEPAEVRWRLQPQEANVEITIYRFRDMSQSWNVPDDEGTRCWSSNQPRAALGHVVLEAA
ETVLRLHGEAGYREKWVQHDFPGAVLDDLRRLHRRDDGCRHKSCQVNVHS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtgatcttcggttcagctgggagctgaccggctctgggtgggcgacgtatcgg
attgccgacgccacgtcggagagggcggacatcgtcagctattgcaccgatgccctgtcc
gacttgttgcgcgcggtggtgagtctctacggagcagccgatgccgcgcgcgtctccttc
gacctcgaacccgccgaggtgaggtggcgactccaaccccaggaggcaaatgtggagatc
accatctaccgattccgggacatgtcccagagctggaacgttcccgatgacgagggcacc
cgctgctggagttccaatcagccccgtgccgccctaggccatgtggtgctggaggccgcc
gagacggtgttgcggctgcacggagaggctggctaccgggagaagtgggtacagcacgac
ttccccggcgcagttctggacgatctccgacggctccaccggcgggacgacgggtgccgc
cacaagagctgccaggtcaacgtccattcctga

DBGET integrated database retrieval system