KEGG   Streptomyces coelicolor: SCO3792
Entry
SCO3792           CDS       T00085                                 

Gene name
SCH63.39
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sco  Streptomyces coelicolor
Pathway
sco00450  Selenocompound metabolism
sco00970  Aminoacyl-tRNA biosynthesis
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO3792 (SCH63.39)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SCO3792 (SCH63.39)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sco01007]
    SCO3792 (SCH63.39)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sco03016]
    SCO3792 (SCH63.39)
Enzymes [BR:sco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SCO3792 (SCH63.39)
Amino acid related enzymes [BR:sco01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SCO3792 (SCH63.39)
Transfer RNA biogenesis [BR:sco03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SCO3792 (SCH63.39)
 Prokaryotic type
   Other AARSs
    SCO3792 (SCH63.39)
SSDB
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF1659
Other DBs
NCBI-GeneID: 1099228
NCBI-ProteinID: NP_627982
Kitasato: SCO3792
UniProt: Q9F2I9
Position
4169611..4171227
AA seq 538 aa
MAATGTEKQGAKAYYVSTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDE
HGQKIMRTAEANGVTPQAWADKLVTESWKPLWEHLDIANDDFIRTTQKRHTDRVQEFVQD
LYDKGEIYKGGYEGPYCVGCEEYKLPGELLDGEGEYAGQKLCPIHKKPVEILSEENYFFK
LSEYSEKLLAHYEANPGFVQPESARNEVVNFVRQGLQDLSISRSTFDWGVPVPWDDKHVI
YVWVDALLNYATAVGYNENPEKFESTFPADVHLVGKDILRFHAIIWPAMLMAQGLPLPGK
IAANGWLMVGGEKMSKSNLTGIKPQDLTTHFGVDAYRWYFLRAIAFGQDGSFSWEDFSAR
YTSELANDYGNLASRVAAMVGKYFGGELPAATADGDAEQAIHDGLTKAVAEADRKIGEEL
DFQGGILAVFDFVKQVNGYITEQEPWKVAKDDSPEGKARLATILYTAAEALRAVAVLLNP
IMPDTSQKLWDSLGAEPSLGALADQHVQDAADWGRLPAGATVTKGAVLFPRLEEKPAA
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggcggccactggaaccgagaagcagggggcgaaggcgtactacgtctcgacccccatc
tactacgtcaacgacgctcctcacctgggccacgcctatacgaccgtcgcaggcgacgtg
ctcacccgctggcaccgccagcgcggcgagaaggtgtggtacctcaccggcacggacgag
cacggtcagaagatcatgcgcacggccgaggcgaacggggtcaccccgcaggcctgggcc
gacaagctcgtcacggagtcctggaagcccctgtgggagcacctcgacatcgcgaacgac
gacttcatccgcaccacgcagaagcggcacaccgaccgcgtccaggagttcgtgcaggac
ctgtacgacaagggcgagatctacaagggcggctacgagggcccgtactgcgtgggctgc
gaggagtacaagctccccggcgagctgctcgacggcgagggcgagtacgcgggccagaag
ctgtgcccgatccacaagaagccggtggagatcctcagcgaggagaactacttcttcaag
ctcagcgagtacagcgagaagctgctcgcccactacgaggccaacccgggcttcgtccag
cccgagtccgcgcgcaacgaggtcgtgaacttcgtccgccagggcctccaggacctctcc
atctcccgctcgaccttcgactggggcgtgccggtcccctgggacgacaagcacgtcatc
tacgtgtgggtcgatgccctgctgaactacgccacggcggtcggctacaacgagaacccg
gagaagttcgagtcgacgttccccgccgacgtgcacctggtcggcaaggacatcctccgc
ttccacgcgatcatctggccggcgatgctgatggcgcaagggctgcccctgccggggaag
atcgccgcgaacggctggctgatggtcggcggcgagaagatgtcgaagtccaacctgacc
ggcatcaagccgcaggacctgaccacgcacttcggtgtggacgcctaccgctggtacttc
ctgcgcgcgatcgccttcggccaggacggctcgttctcctgggaggacttctccgcccgc
tacaccagcgagctggccaacgactacggcaacctcgcctcccgcgtggcggccatggtc
ggcaagtacttcggcggcgagctgccggccgcgacggccgacggcgacgcggagcaggcc
atccacgacggcctgaccaaggccgtggccgaggccgaccggaagatcggcgaggagctg
gacttccagggcggcatcctggcggtcttcgacttcgtcaagcaggtcaacggctacatc
accgagcaggagccctggaaggtcgcgaaggacgattcgccggaggggaaggcgcgcctg
gcgacgatcctctacacggccgcggaagcactccgcgccgtggcggtcctcctgaacccg
atcatgccggacacctcccagaagctctgggactccctcggcgccgagccctccctgggc
gccctcgcggaccagcacgtccaggacgcggcggactggggccggctgcccgccggtgcc
acggtcaccaagggcgcggtgctcttcccgcgtctcgaggagaagcctgccgcgtaa

DBGET integrated database retrieval system