KEGG   Streptomyces coelicolor: SCO4121
Entry
SCO4121           CDS       T00085                                 
Symbol
SCD72A.07c
Name
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: MFS_1 MFS_1_like PUCC Mpv17_PMP22 OppC_N
Other DBs
NCBI-GeneID: 1099558
Kitasato: SCO4121
UniProt: Q9KYE9
Position
complement(4528045..4529322)
AA seq 425 aa
MGAAMRRIHVGNALSAFGLGFTVPYLYVYVAQVRGLGSVTAGLVLAVFAVAALIVLPFAG
RAIVRRGPLPVLLVALVTAALGALSLGLSASAGTVLLSAAALGAGQAVMQPALATMIVDC
STTETRSRAFAMQFFLQNLGLGVGGLIGGHLVDTTSPSSFTLLFAIEAAMFLVLVAVMAT
VRTPRAPRIEGALGQAGGGSWKQLLGNRAMVQLCVLGFVLFFACYGQFESGLSAYGVEAA
GISTSALGTALAANTLVIVIAQFAVLKFVERRKRSRVIASVGLIWAVAWAVAGYAGLGHG
SQTMATAAFISTYALFGLGEAMLSPTLAPLVADLAPTGLAGQYNSAFALVKQLALAIGPA
VGGPLGASLHAPYIVAFLLFSLGITVLAVRLGRQLTDVQNQPSLARSRVVTQGGAPADAV
VSAEA
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgggcgcggcgatgcgccggatccacgtgggcaacgcactcagcgcgttcggactcggc
ttcacggtcccctacctgtacgtctatgtggcgcaggtacggggactgggttctgtcacg
gcgggcctcgtgctcgccgtcttcgccgtggccgcgctgatcgtgctgccgttcgccggg
cgggccatcgtccggcgtggtccgctgccggtactgctggtcgccctggtcaccgccgcg
ctcggcgcgctgagcctcgggctgtcggcctcggccggcaccgtgctgctgtccgccgcc
gcgctgggagccgggcaggccgtgatgcagcccgcgctcgcgacgatgatcgtggactgc
tcgacgacggagacccggtcgcgtgcgttcgcgatgcagttcttcctgcagaacctgggg
ctcggcgtcggagggctcatcggcggtcacctggtcgacaccacgagcccgtcgtccttc
acgctgctgttcgccatcgaggcggcgatgttcctggtgctggtggccgtcatggcgacg
gtgcggacgccgcgtgcgccgcggatcgagggggcgctgggacaggccggcggcgggagc
tggaagcagctcctcggcaaccgggccatggtgcagctgtgcgtcctgggcttcgtgctg
ttcttcgcctgctacgggcagttcgagtcggggctgagcgcgtacggcgtcgaggcggcc
gggatctccacgtccgcgctgggtaccgcgctggcggcgaacacgctggtgatcgtgatc
gcgcagttcgcggtgctgaagttcgtggagcggcgcaagcggtcccgggtcatcgcgtcc
gtggggctgatctgggccgtggcgtgggccgtggccggatacgccgggctgggacacggc
agccagacgatggccacggccgccttcatctcgacgtacgcgctgttcgggctgggtgag
gcgatgctgtcgccgacgctggcgccgctggtggcggacctggcgccgaccggtctcgcc
gggcagtacaactccgccttcgccctggtgaagcagctcgcgctggcgatcggtccggcg
gtcggcgggccgctcggggcctcgctgcacgcgccgtacatcgtggcgttcctgctgttc
tcgctgggcatcacggtgctggcggtgcggctggggcggcagctcaccgatgtccagaat
cagccgtcgctggccaggagccgggtggtcacgcagggcggggcgccggccgacgccgtg
gtgtccgcggaggcgtga

DBGET integrated database retrieval system