KEGG   Streptomyces coelicolor: SCO4284Help
Entry
SCO4284           CDS       T00085                                 

Gene name
SCD95A.17c
Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sco  Streptomyces coelicolor
Pathway
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO4284 (SCD95A.17c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SCO4284 (SCD95A.17c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 1099724
NCBI-ProteinID: NP_628456
Kitasato: SCO4284
UniProt: Q9KXV7
Position
complement(4699398..4700543)
Genome map
AA seq 381 aa AA seqDB search
MAPSKVLAGARVVLPTGTVDDGRVIVDGARIADTAPPQAETVDLAGHWVVPGFVDIHNHG
GGGASFAGGTAEEILAGVETHRRHGTTTVVASAVTGDLDFLARHAGMLAELAQQGDIVGI
HFEGPFISPCRKGAHDEQLLRDPDPAEVRKLVDAAHGHAKMMTLATELPGGLDSVRLLVE
HGVIAAVGHTDATYEQTVQAIDAGATVATHLFNAMPPVGHRAPGPITALLEDERITVELI
NDGTHLHPAALQLAFHHAGAARVAFITDAMDAAGFGDGHYLLGPLEVEVADGVARLVEGG
SIAGSTLTLDRAFKRAVTVDRLPVGDVVAAISANPARLLGLDDRIGSLEPGKDADLVVLD
DAFDLVGVMRRGEWVVDPHLG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggccccaagcaaggttctcgccggtgcccgggtggtactgcccaccgggaccgtggac
gacggccgcgtgatcgtcgacggcgcgcggatcgcggacacggctcccccgcaggccgag
accgtcgacctggcgggccactgggtggtccccggcttcgtcgacatccacaaccacggc
ggcggcggagcctccttcgccggcggcaccgccgaggagatcctggccggcgtcgagacc
caccgccggcacggcaccaccacggtggtcgcctccgccgtcaccggcgatctggacttc
ctggcccggcacgccgggatgctcgccgagctggcgcagcagggcgacatcgttggcatc
cacttcgaggggccgttcatctcgccgtgccgcaagggcgcgcacgacgagcagctgctg
cgcgacccggacccggccgaggtgcgcaagctggtcgacgcggcgcacgggcacgcgaag
atgatgacgctggcgaccgagctgccgggcggcctggactccgtacggctgctggtcgag
cacggcgtgatcgcggccgtcgggcacaccgacgcgacgtacgagcagaccgtgcaggcc
atcgacgcgggcgccaccgtcgccacgcacctcttcaacgcgatgccgccggtcggtcac
cgtgcgccgggtccgatcacggcgctcctcgaggacgagcggatcaccgtcgagctgatc
aacgacggcacgcacctgcatccggccgcgctccaactggccttccaccacgcgggtgcc
gcccgggtcgccttcatcaccgacgcgatggacgcggcgggcttcggcgacggccactac
ctgctcggcccgctggaggtcgaggtcgcggacggcgtggcccggctggtggagggcggc
tcgatcgcgggctccacgctcaccctggaccgcgccttcaagcgggcggtgacggtggac
cggctgcccgtcggggacgtcgtcgcggcgatctccgccaacccggcgcggctcctcggt
ctcgacgaccggatcggctcgctggagcccggcaaggacgccgacctggtcgtcctggac
gacgccttcgacctggtgggcgtgatgcgccggggcgaatgggtggtcgatccccacctg
ggctga

DBGET integrated database retrieval system