KEGG   Streptomyces coelicolor: SCO4332
Entry
SCO4332           CDS       T00085                                 

Gene name
SCD12A.15c
Definition
(RefSeq) integral membrane ATPase
  KO
K12952  cation-transporting P-type ATPase E [EC:7.2.2.-]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO4332 (SCD12A.15c)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase Hydrolase_3 HAD Cation_ATPase_C DUF2919 Wzy_C_2
Other DBs
NCBI-GeneID: 1099772
Kitasato: SCO4332
UniProt: Q9KXM5
Position
complement(4746028..4748436)
AA seq 802 aa
MTHLDADRLDPEHPAHAVDAPSPATGLTAAGVAERIARGQVNDVPVRSSRSLADIVRANV
FTRFNAIIGVLWVIMLFVAPIQDSLFGFVILANTGIGIIQEWRAKKTLDSLALIGEVRPT
VRRDGKPVGISTSEIVLDDVIEIGPGDKAVVDGVCVEADGLEIDESLLTGEADPVVKQPG
DQVMSGSFVVAGGGAFRATKVGREAYAAQLAEEASRFTLVQSELRSGISTILKYVTWMMV
PTAIGLILSQLLAKDNDLDDSIARTVGGIVPMVPEGLVLLTSVAFAIGVVRLGRKQCLVQ
ELPAIEGLARVDTVCLDKTGTLTEGGMDVTDLRVLDGADERHVRAVLGALGASDPRPNAS
LQAIIDTYPDDGSAGAWRNTRSLPFSSARKYSGATFDEGDGAAGTWLLGAPDVLLPEDDP
ALAETGRLNEQGLRVLLLARAARDLDDPEVAEGVEPTALVVLEQRLRPDAADTLRYFADQ
DVRAKVISGDNAVSVGAVAAKLGLSGATVDARRLPAEREEMAGALDEGTVFGRVTPQQKR
DMVAALQSRGHTVAMTGDGVNDVLALKDADIGVAMGSGSEATRAVAQIVLLNNSFATLPS
VVAEGRRVIGNITRVATLFLVKTVYSVLLAILVVCSQVEYPFLPRHLTLLSTLTIGVPAF
FLALAPNRERARPHFVRRVMRYAIPGGVVAGAATFVTYLVARQHYTGPGALDAETSAATL
TLFLISMWVLAIIARPYTWWRVLLVAAMGLGFVVVLAVPWLQDFFALKLVGVTMPWTAVG
IAVAGAAVLELTWGWVDRRFPV
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgacgcatctcgacgcggacagactcgacccggagcatcccgcgcacgccgttgacgcc
ccttcgcccgcgaccgggctcacggcggccggggtcgccgaacggatcgcccgcggccag
gtcaacgacgtgccggtgcgcagcagccgttccctggccgacatcgtccgcgccaacgtc
ttcacccggttcaacgcgatcatcggcgtgctctgggtgatcatgctgttcgtcgcgccg
atccaggacagcctgttcggcttcgtgatcctcgccaacaccggcatcggcatcatccag
gagtggcgggcgaagaagaccctcgactccctggccctgatcggcgaggtccgcccgacg
gtgcgccgggacgggaagcccgtcgggatcagcacgtccgagatcgtgctggacgacgtc
atcgagatcggtcccggcgacaaggccgtggtcgacggggtgtgcgtcgaggccgacggg
ctggagatcgacgagtccctgctgaccggcgaggccgacccggtggtcaaacagccgggc
gaccaggtcatgtcgggcagcttcgtggtcgcgggcggcggcgccttccgggccaccaag
gtcggccgcgaggcgtacgcggcgcagctcgccgaggaggcctcccgcttcacgctggtc
cagtccgagctgcgctccggcatctccacgatcctcaagtacgtcacctggatgatggtc
ccgaccgcgatcggcctgatcctcagccagctgctcgccaaggacaacgacctggacgac
tcgatcgcccgcacggtcggcggcatcgtgcccatggtccccgagggcctggtcctgctc
acctccgtcgccttcgcgatcggcgtcgtccggctcggccgaaagcagtgcctcgtccag
gagctgcccgccatcgagggcctggcccgcgtcgacaccgtctgcctggacaagaccggc
accctcaccgagggcggcatggacgtcaccgacctgcgcgtcctcgacggcgccgacgag
cgtcacgtccgcgccgtgctcggcgccctcggcgcgtccgacccgcgccccaacgcctcc
ctccaggcgatcatcgacacctacccggacgacgggtccgccggggcgtggcggaacacg
cggtcgctgcccttctcctccgcccgcaagtacagcggcgccaccttcgacgagggcgac
ggcgccgccgggacgtggctgctgggcgccccggacgtgctgctgcccgaggacgacccg
gcgctcgccgagaccggccggctcaacgaacagggcctgcgcgtactgctgctcgcccgc
gccgcccgcgacctggacgaccccgaggtcgccgagggcgtcgagcccaccgccctggtg
gtgctggagcagcggctgcgcccggacgccgccgacaccctgcgctacttcgccgaccag
gacgtgcgcgccaaggtcatctccggcgacaacgcggtgtcggtcggcgcggtggccgcc
aagctcgggctgtccggcgccaccgtcgacgcgcgccggctgcccgccgagcgggaggag
atggcgggtgccctggacgagggcacggtgttcggccgggtcaccccgcagcagaagcgg
gacatggtggccgccctccagtcacgcggccacaccgtcgcgatgaccggcgacggcgtc
aacgacgtcctcgcgctcaaggacgccgacatcggcgtggcgatgggctccggctcggag
gcgacccgggcggtcgcgcagatcgtgctgctcaacaacagcttcgccacgctgccgtcg
gtggtggccgagggccgccgcgtcatcggcaacatcacgcgcgtggcgacgctgttcctg
gtcaagaccgtgtactcggtgctgctcgcgatcctggtggtctgctcgcaggtggagtac
ccgttcctgccccgccacctcaccctgctctcgacgctcaccatcggcgtcccggccttc
ttcctggccctcgccccgaacagggaacgggccaggccccacttcgtccggcgcgtgatg
cggtacgcgatcccgggcggggtggtggcgggggcggcgaccttcgtgacgtatctcgtc
gcccggcagcactacaccggcccgggcgcgctggacgcggagaccagcgcggcgacgctg
acgctgttcctgatctcgatgtgggtgctggcgatcatcgccaggccgtacacgtggtgg
cgggtgctgctggtggcggcgatggggctgggcttcgtggtggtgctggcggtgccgtgg
ctgcaggacttcttcgcgctgaagctggtgggggtgacgatgccgtggactgccgtcggc
atcgcggtggcaggggcagccgttctggagctcacctgggggtgggtggaccggcggttt
cccgtatga

DBGET integrated database retrieval system