KEGG   Streptomyces coelicolor: SCO4446
Entry
SCO4446           CDS       T00085                                 

Symbol
SCD6.24
Name
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 1099886
Kitasato: SCO4446
UniProt: Q9KZY0
Position
4867733..4868950
AA seq 405 aa
MPDTPRRTYADLFRTPEFSPLFLSSSANIAAQTVSGLALGTLVFRATESPLLSAVSMFGP
ALAQVLGATFFLSGADRLPPRATLAGLSLSFAAATAALALPGLPVWAMLVIVLVEGLIAS
LGGGVRWGLLTEILAKDGYLTGRSLFNMMSGLMQIAGYATGGVLVVLLSPRLCLLLAAGL
YGTSAALALRLTRRPPRVAGRPSVRATWWANSLLWSARPRRHVYLALWVPNGLVVGCESL
FVSYDPRAAGTLFACGALGMLAGDVTIGRLLPARLRPRLGIPLLALLAAPYLVLFLRPPL
PLTAVLVGLASVGFGASLVQQERLVTLTPDELSGHALGLHSAGMLTMQGLAAVLAGTVAQ
FTSPATAMSVMALASLTVTLTLTAASRRGAPDGGLLPTRAAVRSA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgccggacacaccccgcaggacgtacgcggacctcttccgcacccccgagttcagcccc
ctcttcctctcctcctccgccaacatcgccgcccagacggtgagcgggctcgcgctcggc
accctggtgttccgggcgacggaatcgccgctgctgtccgcggtcagcatgttcggcccg
gcgctcgcccaggtgctgggcgccaccttcttcctctccggcgccgaccggctgccgccc
cgcgcgacgctggcgggcctctcgctctccttcgccgccgccaccgcggccctcgcgctg
cccggcctgccggtgtgggcgatgctcgtcatcgtgctcgtcgaggggctgatcgcctcg
ctcggcggcggcgtccgctggggcctgctcaccgagatcctcgccaaggacggttacctg
accgggcgttcgctcttcaacatgatgagcggcctcatgcagatcgccggatacgcgacc
ggcggcgtcctggtggtcctgctgtcgccacgcctgtgcctgctgctcgcggccggtctg
tacggcacctcggccgccctcgccctgcgcctgacccgccggccgccccgggtcgccggc
cgcccttccgtccgggccacctggtgggccaactccctgctctggtcggcccgtccgcgc
cgccacgtgtacctggccctgtgggtgcccaacggcctcgtcgtgggctgcgagtcgctg
ttcgtctcctacgacccgcgcgccgcgggcaccctgttcgcctgcggggcgctgggcatg
ctcgccggggacgtgacgatcggccggctgctgcccgcccggctgcgcccgcggctcggc
atcccgctcctggcgctgctggccgccccgtacctcgtcctcttcctgcgcccgccgctg
ccgttgacggccgtcctggtcggcctggcgtcggtgggcttcggcgcgagcctggtgcag
caggagcgcctggtcaccctgacccccgacgaactctccgggcacgccctcgggctgcac
tccgccgggatgctcaccatgcagggcctcgccgcggtcctggcgggcacggtggcccag
ttcacctcaccggcgacggccatgtccgtgatggcgctcgcctcgctcacggtgacgctc
acgctgacggcggcgagccggcggggcgcgcccgacgggggactgctgccgacccgggcg
gcggtacggtccgcgtga

DBGET integrated database retrieval system