KEGG   Streptomyces coelicolor: SCO4581
Entry
SCO4581           CDS       T00085                                 

Gene name
SCD16A.02c
Definition
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: Hydrolase_3 HAD S6PP Hydrolase
Other DBs
NCBI-GeneID: 1100021
Kitasato: SCO4581
UniProt: Q9XAS3
Position
5002738..5003547
AA seq 269 aa
MDRTAYSLVATDLDGTLLRGDDTVSDRSLAALARVAGAGARHLVVTGRPAPRVRPLLDRL
GCTGLAVCGQGAQVYDAGAHRMLWSVTLDRELAETALGKIEAEVGQVHAAVDQDGVDGLT
LIEPDYLMPHPTLPAVRVERRAQLWSTPISKVLLRHPELTDDELAATARAVVGSLATVTM
SGPGTVELQPCGITKATGLALAAEHLGLERRRTIAFGDMPNDIPMFQWAAHGVAMAGAHP
ELKAVADEVTTTNEDDGVAVVLERIFGTS
NT seq 810 nt   +upstreamnt  +downstreamnt
atggaccgcaccgcatattcactcgtcgccaccgacctggacggcacgctgctccgaggc
gacgacaccgtctccgaccggtcgctggccgcgctggcacgggtagccggggcgggtgcg
cgccacctggtggtgacggggcgcccggccccccgggtgcgcccgctgctcgaccggctc
ggctgcacgggactcgcagtgtgcggacagggcgcgcaggtctacgacgccggcgcgcac
cggatgctgtggtcggtcaccctggaccgggagctggccgagaccgcgctcggcaagatc
gaggccgaggtgggccaggtgcacgcggccgtggaccaggacggcgtcgacggactgacg
ctcatcgagccggactacctgatgccccacccgacgctgcccgcggtgcgcgtcgagcgg
cgggcgcagctgtggtccacgccgatcagcaaggtgctgctgcgccaccccgagctgacc
gacgacgaactggcggcgacggctcgcgcggtggtcggttccctcgcgacggtcaccatg
tcggggcccggcacggtggagctccagccctgcggcatcaccaaggccaccggtctggcg
ctggccgccgagcatctggggctggagcggcggcggacgatcgccttcggggacatgccc
aacgacatcccgatgttccagtgggcggcccacggtgtggccatggccggcgcgcacccc
gaactcaaggcggtggccgacgaggtcaccacgacgaacgaggacgacggcgtggccgtc
gtcctcgagcggatcttcggtacctcttag

DBGET integrated database retrieval system