KEGG   Streptomyces coelicolor: SCO4661
Entry
SCO4661           CDS       T00085                                 

Gene name
fusA
Definition
(RefSeq) elongation factor G
  KO
K02355  elongation factor G
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sco03012]
    SCO4661 (fusA)
   03029 Mitochondrial biogenesis [BR:sco03029]
    SCO4661 (fusA)
Translation factors [BR:sco03012]
 Eukaryotic type
  Elongation factors
   SCO4661 (fusA)
 Prokaryotic type
   SCO4661 (fusA)
Mitochondrial biogenesis [BR:sco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SCO4661 (fusA)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    SCO4661 (fusA)
SSDB
Motif
Pfam: GTP_EFTU EFG_IV EFG_III EFG_C GTP_EFTU_D2 RF3_C MMR_HSR1
Other DBs
NCBI-GeneID: 1100102
Kitasato: SCO4661
UniProt: P40173
Position
5089830..5091956
AA seq 708 aa
MATTSLDLAKVRNIGIMAHIDAGKTTTTERILFYTGVSYKIGEVHDGAATMDWMEQEQER
GITITSAATTCHWPLEDNDYTINIIDTPGHVDFTVEVERSLRVLDGAVTVFDGVAGVEPQ
SETVWRQADRYGVPRICFVNKLDRTGAEFHRCVDMISDRLGAQPLVMQLPIGAEADFQGV
VDLVRMKALVWSADAAKGEMYDVVDIPATHTEAAEEWRGKLVEAVAENDEEVMELFLEGQ
EPTEEQLYAAIRRVTIASGKSSDTTVTPVFCGTAFKNKGVQPLLDAVVRYLPTPLDVEAI
EGHDVKDPEVVVKRKPSEDEPLAALAFKIMSDPHLGKLTFVRVYSGRLVSGTAVLNSVKG
RKERIGKIYRMHANKREEIESVGAGDIVAVMGLKQTTTGETLSDDKSPVILESMDFPAPV
IQVAIEPKSKGDQEKLGVAIQRLAEEDPSFQVHTNEETGQTIIGGMGELHLEVLVDRMRR
EFKVEANVGKPQVAYRETIRKTVERVDYTHKKQTGGTGQFAKVQIAIEPIEGGDASYEFV
NKVTGGRIPKEYIPSVDAGAQEAMQFGILAGYEMTGVRVTLIDGGYHEVDSSELAFKIAG
SQAFKEAARKASPVLLEPMMAVEVTTPEDYMGDVIGDINSRRGQIQAMEERMGARVVKGL
VPLSEMFGYVGDLRSKTSGRASYSMQFDSYAEVPRNVAEEIIAKAKGE
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggctaccacttcacttgacctggccaaggtccgcaacatcgggatcatggcccacatc
gacgcgggcaagacgaccaccaccgagcggatcctgttctacaccggcgtctcgtacaag
atcggtgaggtccacgacggcgccgccacgatggactggatggagcaggagcaggagcgt
ggcatcacgatcacgtctgctgcgaccacctgtcactggccgctcgaggacaacgactac
acgatcaacatcatcgacaccccggggcacgtcgacttcaccgtcgaggtggagcggtcc
ctgcgtgtgctcgacggtgccgtgaccgtgttcgacggtgtcgccggtgtcgagccccag
tccgagacggtgtggcgtcaggccgaccgttacggcgtgccccgcatctgcttcgtgaac
aagctggaccgcaccggcgccgagttccaccgctgcgtggacatgatctcggaccgcctg
ggcgcccagccgctggtcatgcagctcccgatcggtgccgaggccgacttccagggcgtc
gtggacctggtccgcatgaaggcgctcgtgtggtccgccgacgcggccaagggcgagatg
tacgacgtcgtcgacatcccggccacgcacaccgaggccgccgaggagtggcgcggcaag
ctggtcgaggccgtcgcggagaacgacgaagaggtcatggagctgttcctggagggccag
gagcccaccgaggagcagctgtacgccgcgatccgtcgcgtcaccatcgcctccggcaag
tccagcgacaccacggtcaccccggtgttctgcggcaccgcgttcaagaacaagggcgtc
cagcccctgctcgacgcggtcgtgcgctacctgccgaccccgctcgacgtcgaggccatc
gagggccacgacgtcaaggaccccgaggtcgtcgtcaagcgcaagccgtcggaggacgag
ccgctcgccgcgctcgcgttcaagatcatgagcgacccgcacctcggcaagctcaccttc
gtccgggtgtactccggccgcctggtgtccggcaccgcggtgctgaactccgtcaagggc
cgcaaggagcgcatcggcaagatctaccgcatgcacgccaacaagcgtgaggagatcgag
tcggtgggcgccggtgacatcgtcgccgtcatgggcctgaagcagaccaccaccggtgag
acgctgtccgacgacaagagcccggtcatcctggagtccatggacttcccggccccggtc
atccaggtcgccatcgagcccaagtcgaagggcgaccaggagaagctcggcgtcgcgatc
cagcgcctggccgaggaggacccgtccttccaggtccacaccaacgaggagaccggccag
accatcatcggtggtatgggcgagctgcacctcgaggtgctggtcgaccgcatgcgccgt
gagttcaaggtcgaggccaacgtcggtaagccccaggtcgcctaccgtgagacgatccgc
aagaccgtcgagcgcgtggactacacccacaagaagcagaccggtggtaccggtcagttc
gccaaggtgcagatcgcgatcgagccgatcgagggcggcgacgcctcgtacgagttcgtg
aacaaggtgaccggtggccgcatcccgaaggagtacatcccttcggtggacgccggtgcg
caggaggccatgcagttcggcatcctggccggctacgagatgacgggcgtccgcgtcacg
ctcatcgacggtggctaccacgaggtcgactcctccgagctcgccttcaagatcgccggt
tcgcaggccttcaaggaggccgcgcgcaaggcttcgcccgtgctgctcgagccgatgatg
gccgtcgaggtcaccacgcccgaggactacatgggcgacgtcatcggcgacatcaactcc
cgccgtggccagatccaggccatggaggagcggatgggtgcccgcgtcgtgaagggcctc
gtgccgctgtcggagatgttcggctacgtcggagacctccgcagcaagacgtcgggtcgc
gcaagctactcgatgcagttcgactcctacgccgaggttccccggaacgtcgccgaggag
atcatcgcgaaggccaagggcgagtaa

DBGET integrated database retrieval system