KEGG   Streptomyces coelicolor: SCO5080
Entry
SCO5080           CDS       T00085                                 

Gene name
actVA5, SCBAC28G1.06
Definition
(RefSeq) hydrolase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
sco  Streptomyces coelicolor
Pathway
sco01057  Biosynthesis of type II polyketide products
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00779  Dihydrokalafungin biosynthesis, octaketide => dihydrokalafungin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SCO5080 (actVA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sco01008]
    SCO5080 (actVA5)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     SCO5080 (actVA5)
Polyketide biosynthesis proteins [BR:sco01008]
 Polyketide tailoring proteins
  Oxygenase
   SCO5080 (actVA5)
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M
Other DBs
NCBI-GeneID: 1100521
Kitasato: SCO5080
UniProt: Q53907 Q7AKH7
Position
5521738..5522883
AA seq 381 aa
MSEDTMTQERPSLTAHARRIAELAGKRAADAEQQRRLSPDVVDAVLRAGFAAHFVPVAHG
GRAATFGELVEPVAVLGEACASTAWYASLTASLGRMAAYLPDEGQAELWSDGPDALIVGA
LMPLGRAEKTPGGWHVSGTWPFVSVVDHSDWALICAKVGEEPWFFAVPRQEYGIVDSWYP
MGMRGTGSNTLVLDGVFVPDARACTRAAIAAGLGPDAEAICHTVPMRAVNGLAFALPMLG
AARGAAAVWTSWTAGRLAGPTGQNAVSSQDRVVYEHTLARATGEIDAAQLLLERVAAVAD
AGSATGVLVGRGARDCALAAELLTAATDRLFASAGTRAQAQDSPMQRLWRDVHAAGSHIG
LQFGPGAALYAGELLRRSNDG
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagcgaggacacgatgacccaggagcggccgtccctgacggcacacgcccgccggatc
gccgaactcgccgggaagcgggcggccgacgccgaacagcagcgccggctgagccccgac
gtcgtcgacgcggtccttcgagccggtttcgccgcccacttcgtaccggtggcgcacggc
ggccgggccgcgacgttcggggagctggtggagcccgtcgcggtgctcggcgaggcctgt
gcctcgaccgcctggtacgcctcgctcacggcgagcctcggccggatggccgcctacctg
ccggacgagggccaggccgagctgtggtccgacggccccgacgccctgatcgtcggtgcc
ctgatgccgctgggccgggccgagaagaccccgggcggctggcacgtgtcgggcacctgg
ccgttcgtcagcgtcgtggatcactccgactgggcgctgatctgcgccaaggtcggcgag
gagccgtggttcttcgcggtgccgcgacaggagtacgggatcgtcgacagctggtacccg
atgggtatgcgcggaacgggcagcaacacgctcgtcctcgacggggtgttcgtgccggat
gcgcgggcctgcacccgtgcggccatcgcggcaggtctcggtccggatgccgaggcgatc
tgtcacaccgtgcccatgagggcggtcaacgggctggccttcgcactgccgatgctcggc
gcggcccgcggggccgcggccgtgtggacctcgtggaccgccggaagactggccgggccg
accgggcagaacgccgtctcgtcccaggaccgcgtggtgtacgagcacacgctggcccgg
gccacgggtgagatcgacgcggcccagctgctgttggagcgggtcgcggcggtcgccgac
gccggctcggcgaccggcgtactggtcggccgcggggcgcgggactgcgccctggcggcg
gagctgctgaccgccgcgaccgaccggctgttcgcctcggcgggcacccgggcacaggcc
caggacagcccgatgcagcgcctgtggcgcgatgtgcacgcggcgggcagccatatcggg
ctgcagttcgggcccggggcggcgctgtacgccggagagctgttgaggaggagcaacgat
ggctga

DBGET integrated database retrieval system