KEGG   Streptomyces coelicolor: SCO5084
Entry
SCO5084           CDS       T00085                                 
Symbol
actII-3, SCBAC28G1.10
Name
(RefSeq) hypothetical protein
  KO
K06994  putative drug exporter of the RND superfamily
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SCO5084 (actII-3)
SSDB
Motif
Pfam: MMPL Sterol-sensing DUF1515
Other DBs
NCBI-GeneID: 1100525
Kitasato: SCO5084
UniProt: Q53902
Position
5525809..5527944
AA seq 711 aa
MTRTLLSWPGGRRLKWLVLAAWIGLLIVLQPLAGKLGDVESNDAAAWLPGNAESTEVLEL
SEKFQPADTSPTVIVYDRPSGITAADEAKARADATHFADGTGVVGEPYGPVRSDDGKALR
TVVNVHLGKDGWEGLNAAAKDMRAIARPSAPDGLGVHVTGPTGYAADSAESFSSADFKLT
LVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLLAKNAGLTVNAQTAMILTV
LVLGAATDYALLLVARYREELRRHEDRHEAMAVALRRAGPAIVASAATVAVSMLVLLLAA
LNSTKGLGPVCAVGVLVGLLSMMTLLPALLVIFGRWVFWPARPKHGTEPDVTRGLWSRIA
RLVSGRPRAVWVTTSLLLGAVATLAVTLNADGLQQKDGFKTKPESVVGEEILTRHFPAGS
GEPMVVIAKGASADQVHAALETVPGVIEVAPPQVKDGLAYVEATLGAGADSPAAMRSVTA
ARETLARLDGAQARVGGSSAVVHDMREASSRDRGLIIPVILAVVFCILALLLRALVAPLL
LIASVVLSFFTALGLAALFFNHVFDFAGADSAFPLWVFVFLVALGVDYNIFLVTRIKEES
DRLGTRQGALKGLTSTGGVITAAGLVLAGTFAALATLPLVFIAELGFTVAVGVLLDTMIV
RSVLVTALTLDVGRWMWWPHPLARREDPSEDPAVSGMPDSIDSEASTTASR
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgacacgcacactgctgtcctggcccggcggacgccggctcaagtggctggtgctcgcg
gcctggatcggtctgctgatcgtgctccagccgctggcagggaagctcggcgacgtcgag
tccaacgacgccgccgcctggctccccggcaatgcggagtcgaccgaagtgctcgagctg
tccgagaagttccagccggccgacaccagcccgaccgtgatcgtctacgaccgcccgtcc
gggatcacggccgccgacgaggcgaaggcgcgggccgacgccacgcacttcgcggacggc
accggtgtggtgggcgagccctacggcccggtgcgctcggacgacggcaaggccctgcgc
accgtcgtcaacgtccacctcggcaaggacggctgggaggggctcaacgcggccgcgaag
gacatgcgggcgatcgcccggccgagcgccccggacggtctcggcgtccacgtcacgggt
ccgaccggttacgccgccgattccgcagagtccttcagcagcgccgacttcaagctcacc
ctggtcaccctcctcatcgtcgtgacgatcctcgtcgtcacctatcgcagtcccttgctc
tggctgctgccgatgatctccgcgggcatgtccctggtcatctcgcaggccatcgtctac
ctgctggccaagaacgcgggactcacggtcaacgcccagacggcgatgatcctcacggtc
ctggtgctcggcgcggccaccgactacgcgctgttgctcgtcgcccgctaccgcgaggag
ctgcggcggcacgaggaccggcacgaggccatggccgtggcgctgcgccgggccggtccc
gccatcgtggccagcgccgccaccgtcgccgtcagcatgctcgtcctgctgctggccgct
ctgaactccaccaagggtctcggcccggtctgcgccgtcggcgtgctggtcggcctgctg
tcgatgatgacgttgctgcccgccctgctggtgatcttcggacgctgggtcttctggccg
gcccggccgaagcacggtacggagcccgacgtcacccggggtctgtggtcgcggatcgcc
cggctggtgtccggccgtccgcgtgccgtctgggtcaccaccagcctgctgctgggggcg
gtggccacgctggccgtcaccctgaacgccgacggcctccagcagaaggacggtttcaag
accaagccggagtcggtggtgggcgaggagatcctgacccggcacttcccggccggctcc
ggtgaacccatggtcgtcatcgccaagggcgcctcggcggaccaggtgcacgcagctctg
gagaccgtgcccggcgtcatcgaggtcgcaccaccacaggtgaaggacggcctcgcctat
gtcgaggcgacgctcggcgccggggcggactcgccggcggccatgcgttcggtcaccgcg
gcccgcgagacactcgcccggctggacggtgcgcaggcacgggtgggcggcagcagcgcc
gtcgtgcacgacatgcgggaggcgtccagccgcgaccgcggtctgatcattccggtgatc
ctcgccgtggtgttctgcatcctcgcgctgctgctgcgagcactggtggcgccgctgctg
ctgatcgcgagcgtggtgctgtccttcttcaccgcgctcggcctcgccgccctcttcttc
aaccacgtcttcgacttcgcgggagccgattcggccttccccctgtgggtcttcgtcttc
ctggtcgccctgggcgtcgactacaacatcttcctcgtcacccggatcaaggaggagagc
gaccggctcggcacccggcagggcgcgctcaagggcctcacctcgaccggtggcgtgatc
accgcggccgggctggtgctggccgggaccttcgccgcgctggccacgctgccgctggtc
ttcatcgccgagctcggattcacggtcgcggtgggcgtcctgctcgacaccatgatcgtg
cgatcggtcctggtcaccgcgctcactctcgatgtcggccggtggatgtggtggccgcac
ccgctcgcccggcgcgaggacccttccgaggacccagccgtatcaggaatgccagattct
attgattcggaagcctcgaccactgcctctcggtaa

DBGET integrated database retrieval system