KEGG   Streptomyces coelicolor: SCO5092
Entry
SCO5092           CDS       T00085                                 

Gene name
actVB, SCBAC28G1.18
Definition
(RefSeq) actinorhodin polyketide dimerase
  KO
K14631  flavin reductase ActVB [EC:1.5.1.-]
Organism
sco  Streptomyces coelicolor
Pathway
sco01057  Biosynthesis of type II polyketide products
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Module
sco_M00779  Dihydrokalafungin biosynthesis, octaketide => dihydrokalafungin
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SCO5092 (actVB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.-  
     SCO5092 (actVB)
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-GeneID: 1100533
Kitasato: SCO5092
UniProt: Q02058
Position
5534558..5535091
AA seq 177 aa
MAADQGMLRDAMARVPAGVALVTAHDRGGVPHGFTASSFVSVSMEPPLALVCLARTANSF
PVFDSCGEFAVSVLREDHTDLAMRFARKSADKFAGGEFVRTARGATVLDGAVAVVECTVH
ERYPAGDHIILLGEVQSVHVEEKGVPAVYVDRRFAALCSAAGACPSATGRGVPAHAG
NT seq 534 nt   +upstreamnt  +downstreamnt
atggcagccgaccagggaatgctccgggacgccatggcccgggtgccggccggggtggcg
ctcgtcaccgcccatgaccgcgggggagtcccgcacggtttcaccgccagttcgttcgtg
tccgtctcgatggagccgccactggcactggtctgcctggctcgtacggccaactccttc
ccggtgttcgacagttgcggcgagttcgcggtgagcgtgctgcgcgaggaccacacggac
ctggccatgcgcttcgcgcgcaagtccgcggacaagttcgcgggcggggagttcgtccgt
accgcgcggggagcgaccgtgctcgacggagcggtcgcggtcgtcgagtgcacggtccac
gagcgctacccggcgggcgaccacatcatcctgctcggcgaggtccagtccgtgcacgtc
gaggagaagggcgtaccggcggtctacgtggaccgccggttcgccgccctgtgctcggcg
gcgggtgcctgcccgtccgccaccgggcggggcgtgcccgcgcatgccggctga

DBGET integrated database retrieval system