KEGG   Streptomyces coelicolor: SCO5120Help
Entry
SCO5120           CDS       T00085                                 

Gene name
SC9E12.05
Definition
(RefSeq) peptide transport system ATP-binding protein
  KO
K15583  oligopeptide transport system ATP-binding protein
Organism
sco  Streptomyces coelicolor
Pathway
sco01501  beta-Lactam resistance
sco02010  ABC transporters
sco02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SCO5120 (SC9E12.05)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SCO5120 (SC9E12.05)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SCO5120 (SC9E12.05)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO5120 (SC9E12.05)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter
    SCO5120 (SC9E12.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 Mg_chelatase AAA_22 DUF87 AAA_16 NACHT
Motif
Other DBs
NCBI-GeneID: 1100561
NCBI-ProteinID: NP_629269
Kitasato: SCO5120
UniProt: Q9F350
Position
5567385..5568368
Genome map
AA seq 327 aa AA seqDB search
MLLEVRDLHVEFHTRDGVAKAVNGVSYGVDAGETLAVLGESGSGKSVTAQTIMGILDIPP
GRVTAGEILFEGRDLLKLKEEERRKVRGAEMAMIFQDALSSLNPVLTVGAQLAEMFTVHR
GMSRKDAHAKAVELMDRVRIPAAKERVRQYPHQFSGGMRQRIMIAMAMALEPKLIIADEP
TTALDVTVQAQVMDLLAELQRELHMGLILITHDLGVVADVADKIAVMYAGRIVETAPVHD
IYKAPAHPYTRGLLESIPRLDQKGQELYAIKGLPPNLTRIPPGCAFHPRCPMAQDVCRTD
VPPLYDVTESDAERGSACHFWRECLHG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgaagtgcgcgacctgcacgtggagttccacacccgcgacggtgtcgccaag
gccgtcaacggcgtcagctacggcgtggacgcgggcgagaccctcgcggtgctcggcgag
tccggatccggcaagtccgtcaccgcccagacgatcatgggcatcctcgacatcccgccg
ggcagggtcaccgcgggggagatcctcttcgagggccgcgacctgctgaagctgaaggag
gaggaacgccggaaggtccgcggcgccgagatggcgatgatcttccaggacgcgctgtcc
tcgctgaacccggtcctgaccgtcggcgcccagctcgccgagatgttcaccgtgcaccgc
ggcatgtcccgcaaggacgcccacgccaaggccgtcgagttgatggaccgggtccgcatc
ccggccgcgaaggagcgggtgcggcagtacccgcaccagttctccggcgggatgcgccag
cgcatcatgatcgcgatggcgatggccctggagcccaagctgatcatcgccgacgagccg
accaccgccctcgacgtcaccgtccaggcccaggtcatggacctgctcgcggaactccag
cgcgaactgcacatgggcctgatcctcatcacccacgacctcggcgtggtcgccgacgtc
gccgacaagatcgccgtcatgtacgccggccggatcgtcgagacggcacccgtccacgac
atctacaaggccccggcccacccgtacacccgcggcctgctggagtcgatcccgcgcctg
gaccagaagggccaggagttgtacgccatcaagggcctgccgcccaacctgacccggatc
ccgccaggctgcgccttccacccccgctgcccgatggcccaggacgtctgccgcaccgac
gtacctcccctctacgacgtcaccgagtccgacgccgagcggggcagcgcctgccacttc
tggagggagtgcctgcatggctga

DBGET integrated database retrieval system