KEGG   Streptomyces coelicolor: SCO5359Help
Entry
SCO5359           CDS       T00085                                 

Gene name
rpmE
Definition
(RefSeq) 50S ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
sco  Streptomyces coelicolor
Pathway
sco03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sco00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SCO5359 (rpmE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sco03011]
    SCO5359 (rpmE)
Ribosome [BR:sco03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    SCO5359 (rpmE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31
Motif
Other DBs
NCBI-GeneID: 1100799
NCBI-ProteinID: NP_629498
Kitasato: SCO5359
UniProt: Q9K4E5
Position
5830020..5830244
Genome map
AA seq 74 aa AA seqDB search
MKRDIHPEYVETQVSCTCGASFTTRSTIESGTIRAEVCSECHPFYTGKQKILDTGGRVAR
FEARFGKASAGSKK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgcgacatccaccccgagtacgtcgagacgcaggtcagctgcacctgtggcgcg
tcgttcaccacccgcagcacgatcgagagcggcaccatccgcgccgaggtctgctccgag
tgccacccgttctacacgggcaagcagaagatcctcgacaccggtggccgcgtggcccgc
ttcgaggcccgcttcggcaaggcttccgccggctccaagaagtag

DBGET integrated database retrieval system