KEGG   Streptomyces coelicolor: SCO5397
Entry
SCO5397           CDS       T00085                                 

Gene name
SC8F4.01c
Definition
(RefSeq) large Ala/Glu-rich protein
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: V-ATPase_G_2
Other DBs
NCBI-GeneID: 1100837
Kitasato: SCO5397
UniProt: Q9L2C3
Position
complement(5865809..5869789)
AA seq 1326 aa
MRGYESQEREPAADVDHLSRFEAEMKRLKTEREKAIQHAEDLGYQVEVLRAKLHEARRTI
MSRPAFDGGDIGYQAEQLLRNAQTQADQLRADAERELSQARAQTQRILQEHAEQAARLQA
ELHQEAVTRRQQLDQELAERRQTVESHVNENVAWAEQLRARTEQQARRLLDESRAEAEQA
MAAARAEAERLTAEARQRLRSDAESARAEADQILRRARTDAERLLNAASTQAQEATDHAE
QLRSSTASESESTRREVQELSRAAEQRMSEAEEALRKAQAEAEKVVAQAEEAAAKALSSA
EATNEQRTRTAKEQVARLVGEATKDAESTRSEAEQVVADARAEAERIVAEAAEKARTITA
EESATQLSKAAKTAEDVLNKASEDAKRTTKAATEEAERIRTEAEAEADRLRAEAHDIAAE
LKGAAKDDTKEYRAKTVELQEEARRLRGEAEQLRADAVAEGEKIRAEARKEAVAQIEEAA
KTAEELLAKAKADADELRQTATADGEKVRAEAIERATTLRRQAEETLERTRAEAERHRAE
AAERVEELQAEAERAARELREETERAVEARQAEAAEELTRLHTEAEERRSAAEEALSGAR
EEGERIRREAAEESERLRTEAAERVRTLQQQAETEAERLRTEAAADASASRAEGEAVAVR
LRSEASNEAERLKTEAQESADRVRAEAQTAAERIAAEASEALAAAQEEAARRRREAEELL
GSARQEADQERERVREQSEELLASARNRVEEAQAEAVRLVEEADRRATEMVSAAEQHAAQ
VRESVAGLHEQAQEEITGLRSAAEHAAERTRTEAQEEADRVRADAYAERERASEDAGRLR
REAQEETEAAKALAERTVSEAITEADRIRSDVSEHAQRVRTEASDAIAEAEQSASRTRAD
AREDANRIRSDAATQADTLITEARSEAERLTTETAAETDRIRTQTLAEAERVTAEAASES
ERVRTEAATEAERLRTETIAEADRVRAEAGARAEQLVSDATGEAERLRAEAADTVGSAQQ
HAERLRTEADRVRREAAAEAERVTTAAREEAERTLDEARKDANKRRSEAAEQVDTLITET
AAEADKLLTEAQQQAQKTTADAESQADTMVGAARSEADRIVQEATVEGNTRVEKARTDAD
ELLVGARRDATAIRERAEELRERLTSEIEELHERARREAAETMKSAGDRCDALIKAAEEQ
LAKAEAKAKELVSEANSEAGKVRIAAVKKAEGLLKEAEQKKATLVREAEELKAEAVREAR
ATVDEGKRELEVLVRRREDINAEISRVQDVLEALESFEAPGGAKDNGVKAGATVGAPRSG
GKSSDG
NT seq 3981 nt   +upstreamnt  +downstreamnt
gtgcggggctacgagagccaggagcgagagccggcggctgacgtcgaccacctctctcgg
ttcgaggccgagatgaagcggctgaagaccgagcgggaaaaggcgatccagcacgccgag
gacctcggctaccaggtcgaggtgctgcgcgccaagctgcacgaggcgcgccgcaccatc
atgtcccggcccgccttcgacggcggcgacatcgggtaccaggccgagcagttgctgcgc
aacgcgcagacgcaggccgaccagctgcgcgccgacgcggagcgggagctgagccaggcg
cgggcgcagacccagcggatcctccaggagcacgccgagcaggccgccaggctccaggcg
gagctgcaccaggaggcggtcacccgccgccagcagctcgaccaggagctggccgagcgc
cggcagaccgtcgagtcgcacgtcaacgagaacgtggcctgggcggagcagctgcgcgcc
cgcaccgagcagcaggcccggcgcctgctcgacgagtcccgggccgaggccgagcaggcc
atggccgcggcccgcgcggaggccgagcggctgaccgccgaggcccgtcagcggctgcgg
agcgacgcggagagcgcccgcgccgaggccgaccagatcctgcgccgggcgcgcaccgac
gcggagcggctgctgaacgccgcctcgacgcaggcgcaggaggcgaccgaccacgcggag
cagctgcgcagctccaccgcctccgagtcggagtccacccggcgcgaggtgcaggagctg
agccgggccgccgagcagcgcatgtcggaggccgaggaggcgctgcgcaaggcgcaggcc
gaggccgagaaggtggtcgcccaggccgaggaggccgccgccaaggccctgtcgagcgcc
gaggcgaccaacgagcagcgcacccgcaccgccaaggagcaggtcgcccggctggtcggc
gaggccaccaaggacgccgagagcaccaggtccgaggccgagcaggtggtcgcggacgcc
cgtgccgaggccgagcggatcgtcgccgaggccgccgagaaggcccgcacgatcacggcc
gaggagtcggccacccagctgtccaaggcggccaagacggccgaggacgtgctgaacaag
gcgtcggaggacgccaagcggaccacgaaggcggccaccgaggaggccgagcggatccgc
accgaggccgaggccgaggcggaccggctgcgcgccgaggcgcacgacatcgccgcggag
ctgaagggcgcggcgaaggacgacaccaaggagtaccgcgccaagacggtcgaactgcag
gaggaggcgcgccggctgcgcggcgaggccgagcagctgcgggcggacgcggtcgccgag
ggcgagaagatccgcgccgaggcccgcaaggaggccgtggcgcagatcgaggaggcggcg
aagaccgccgaggagctgctcgccaaggccaaggcggacgccgacgagctgcggcagacc
gcgacggcggacggcgagaaggtccgcgccgaggccatcgagcgggcgacgaccctgcgc
cggcaggccgaggagaccctggagcgcacccgcgcggaggccgaacggcaccgcgcggag
gccgccgagcgggtggaggagctccaggcggaggccgagcgggccgcccgcgagctgcgc
gaggagaccgagcgcgccgtcgaggcccggcaggcggaggccgccgaggagctgacgcgg
ctgcacaccgaggccgaggagcgccgcagcgccgccgaggaggcgctgagcggggcccgc
gaggagggcgagcggatccgccgcgaggccgccgaggagagcgagcggctgcgcaccgag
gccgcggagcgggtccgtaccctccagcagcaggccgagacggaggccgagcggctgcgc
accgaggccgccgcggacgcgtccgcctcccgcgcggagggcgaggccgtcgccgtacgg
ctgcgctcggaggcttccaacgaggcggagcggctgaagacggaggcgcaggagagcgcc
gaccgggtgcgggcggaggcgcagaccgccgccgagcgcatcgcggccgaggcgtccgag
gcgctggccgccgcccaggaggaggccgcccggcgccgccgcgaggcggaggaactgctc
ggctccgcccggcaggaggccgaccaggagcgcgagcgggtccgcgagcagagcgaggag
ctgctggcctcggcacgcaaccgcgtggaggaggcccaggccgaggcggtccggctggtc
gaggaggccgaccggcgcgccaccgagatggtgtcggcggccgagcagcacgcggcgcag
gtacgggagtcggtcgccgggctgcacgagcaggcccaggaggagatcaccgggctgcgc
agcgccgccgagcacgccgccgagcgcacccggaccgaggcccaggaggaggcggaccgg
gtccgcgccgacgcctacgcggagcgggagcgggcgagcgaggacgccggacgcctcagg
cgcgaggcgcaggaggagaccgaggccgccaaggcgctggccgagcggaccgtgtccgag
gccatcaccgaggccgaccggatccgctcggacgtctccgagcacgcccagcgggtgcgc
acggaggcctccgacgccatcgccgaggccgagcagtccgcgtcgcgcacccgggcggac
gcccgcgaggacgccaaccgcatccggtccgacgcggcgacgcaggcggacaccctgatc
accgaggcgcgttccgaggcggagcggctcaccaccgagacggcggccgagaccgaccgg
atccgcacccagacgctcgcggaggcggagcgcgtcaccgccgaggcggcgagcgagtcc
gagcgggtcaggacggaggcggccaccgaggcggagcggctgcgcaccgagacgatcgcc
gaggccgaccgggtacgggccgaggcgggcgcccgggccgagcagctggtctcggacgcc
accggggaggcggagcggctgcgggccgaggccgccgacaccgtcggctccgcgcagcag
cacgccgagcggctccgcaccgaggcggaccgggtccgccgcgaggcggccgcggaggcc
gagcgggtcaccacggcggcccgcgaggaggccgagcgcaccctcgacgaggcccgcaag
gacgccaacaaacggcgctcggaggccgccgagcaggtcgacacgctcatcacggagacc
gccgccgaggccgacaagctgctcaccgaggctcagcagcaggcccagaagaccaccgcg
gacgccgagtcgcaggccgacacgatggtcggcgcggcccgctcggaggccgaccggatc
gtccaggaggcgacggtcgagggcaacacccgggtggagaaggcccgtacggacgcggac
gagctgctggtcggcgcccgccgggacgcgaccgccataagggagcgcgcggaggagctg
cgcgagcggctcacctccgagatcgaggagctgcacgagcgggcccgccgcgaggccgcc
gagacgatgaagtcggccggcgaccgctgcgacgcgctcatcaaggccgccgaggagcag
ctcgccaaggcggaggcgaaggcgaaggagctggtgtcggaggccaactccgaggccggc
aaggtgcgcatcgccgccgtcaagaaggccgaggggctgctcaaggaggccgagcagaag
aaggccaccctggtccgcgaggccgaggagctgaaggccgaggcggtccgcgaggcccgg
gccacggtcgacgagggcaagcgcgagctggaggtgctggtccggcgccgcgaggacatc
aacgcggagatctcccgggtccaggacgtgctggaggcgctggagtcgttcgaggcgccc
gggggtgcgaaggacaacggggtgaaggccggagcgacggtgggcgccccacgttcgggt
ggcaagtcgtcagacggctag

DBGET integrated database retrieval system