KEGG   Streptomyces coelicolor: SCO5476
Entry
SCO5476           CDS       T00085                                 

Gene name
SC2A11.10
Definition
(RefSeq) oligopeptide transport integral membrane protein
  KO
K02034  peptide/nickel transport system permease protein
Organism
sco  Streptomyces coelicolor
Pathway
sco02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sco00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SCO5476 (SC2A11.10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO5476 (SC2A11.10)
Transporters [BR:sco02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    SCO5476 (SC2A11.10)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-GeneID: 1100916
Kitasato: SCO5476
UniProt: O86571
Position
5962095..5963102
AA seq 335 aa
MTAPLHEPTAEAAPSAAEEAAVAGAEAKSVQGRSLGRIAWERLKRDKLALAGGIVVLVLI
VVAVFAPLITSLYGQDPNAYNEDMIDPLFGTPTGSLGGLGGEHWLGVEPVNGRDIFARIV
HGARISLLVGFLSAMVAVVLGTVLGVLAGFFGGWVDSLICRIMDGLLAFPQLLFIIALVS
VMPDNMLGLSGTGVRLLMMIVVIGFFGWPYIGRVVRGQTLSMREREYVEAARSLGAGRFY
ILFKELLPNLVAPIIVYTTMMIPTNILTEAALSFLGVGVKPPTSSWGQMLSSAIDYYKSD
PMYMVVPGVAIFITVLAFNLFGDGVRDALDPKGSR
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgacggcaccattgcacgagccgaccgcggaagcggccccgagtgcggcagaggaagcg
gcggtcgccggcgccgaggccaagtcggtacaagggcgttccctgggccggatcgcctgg
gagcgcctgaagcgggacaagctggccctcgcgggcggcatcgtcgtgctggtcctcatc
gtggtcgccgtgttcgcgcccttgatcacctcgctctacgggcaggaccccaacgcgtac
aacgaggacatgatcgacccgctgttcggtacccccacgggttccctgggcggcctcggc
ggcgagcactggctcggcgtggagccggtcaacggccgcgacatcttcgcccgtatcgtc
cacggcgcccggatctcgctgctggtcggcttcctgtccgcgatggtcgccgtggtcctc
ggcaccgtcctcggggtcctcgcgggcttcttcggcggctgggtcgactccctcatctgc
cgcatcatggacggcctgctggccttcccgcagctgctcttcatcatcgccctggtctcc
gtcatgccggacaacatgctcggactgagcggcacgggcgtgcgcctgctcatgatgatc
gtggtcatcggcttcttcggctggccctacatcggtcgcgtggtccgcggtcagacactc
tcgatgcgtgaacgggagtacgtcgaggcggcccggtcgctgggggccggacggttctac
atcctgttcaaggaactgctgcccaacctggtggcgccgatcatcgtgtacacgacgatg
atgatccccaccaacatcctcaccgaggcggcgctcagcttcctgggtgtgggcgtcaag
ccgcccacgtcgtcgtgggggcagatgctctcgagcgcgatcgactactacaagtcggac
cccatgtacatggtggtccccggtgtggcgatcttcatcaccgttcttgccttcaacctc
ttcggtgacggcgtgcgcgacgcgctggacccgaaggggtcccgctga

DBGET integrated database retrieval system