KEGG   Streptomyces coelicolor: SCO5998Help
Entry
SCO5998           CDS       T00085                                 

Gene name
murA2, SCBAC1C11.01c, StBAC16H6.33c
Definition
(RefSeq) UDP-N-acetylglucosamine transferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sco  Streptomyces coelicolor
Pathway
sco00520  Amino sugar and nucleotide sugar metabolism
sco00550  Peptidoglycan biosynthesis
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO5998 (murA2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCO5998 (murA2)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SCO5998 (murA2)
Peptidoglycan biosynthesis and degradation proteins [BR:sco01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   SCO5998 (murA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_37 HTH_19 YdaS_antitoxin HTH_23 HTH_26 Sigma70_r4 HTH_25 MarR HTH_24 DcuA_DcuB
Motif
Other DBs
NCBI-GeneID: 1101440
NCBI-ProteinID: NP_733681
Kitasato: SCO5998
UniProt: Q8CJP9
Position
complement(6573186..6574715)
Genome map
AA seq 509 aa AA seqDB search
MADDYLVRIGRLIRDARQHRGWTQSQLAEALNTSQSAVNRIERGNQNISLEMIARIGEAL
DSEIVSLGYAGPMHLRVVGGRRLSGAIDVKTSKNACVALLCASLLNKGRTVLRRVARIEE
VYRLLEVLNSIGVRTRWINDGTDLEIVPPAELDMEAIDAEAAVRTRSIIMFLGPLLHRME
RFRLPYAGGCDLGTRTIEPHMIALRRFGLDVAATEGHYHAVVDRQVRPDRPIVLTERGDT
VTENALLAAARHDGVTVIRNASSNYMVQDLCFFLEALGVRVEGIGTTTLTVHGMPVIDAD
VDYSPSEDPVEAMSLLAAAVVTESELTVRRVPIEFLEIELAVLEEMGLDHDRTPEYFADN
GRTRLVDLTVRPSKLEAPIDKIHPMPFPGLNIDNVPFFAAIAASAQGQTLIHDWVYDNRA
IYLTDLNRLGGRLQLLDPHRVLVEGPTRWRAAEMMCPPALRPAVVVLLAMMAAEGTSVLR
NVYVINRGYEDLAERLNSIGAQIEIFRDI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgactacctcgtacgcatcggcaggctcatccgtgacgcccggcagcaccgc
ggctggacgcagtcacagctcgcggaggcgctcaacaccagtcagagcgccgtcaaccgc
atcgagcgcggcaaccagaacatcagccttgagatgatcgcccggatcggcgaagcgctg
gacagcgaaatcgtctccctgggctacgcgggtccgatgcacctgcgcgtggtcggcggc
cgtcgcctgtccggcgccatcgacgtcaagaccagcaagaacgcctgcgtggccctgctg
tgcgcctcgctgctcaacaaggggcgcacggtactgcgccgggtcgcccgcatcgaggag
gtctaccgcctcctggaggtgctcaactccatcggcgtgcgcacccgctggatcaacgac
ggcaccgacctggagatcgtgccgccggccgagctggacatggaggccatcgacgccgag
gccgccgtccgcacccgctccatcatcatgttcctcggcccgctgctgcaccgcatggag
cgcttccgcctgccctacgccggcggctgcgacctcggcacccgcaccatcgagccgcac
atgatcgcgctgcgccggttcggcctggacgtcgccgcgaccgagggccactaccacgcg
gtggtcgaccgccaggtgcgcccggaccgccccatcgtcctgaccgagcgcggcgacacg
gtgacggagaacgccctcctggccgccgcccgccacgacggcgtcaccgtcatccgcaac
gcctcctccaactacatggtccaggacctctgcttcttcctggaggccctgggcgtccgc
gtcgaaggcatcggcaccaccaccctcaccgtccacggcatgccggtcatcgacgccgac
gtggactactccccctccgaggacccggtcgaggcgatgagcctgctggccgccgccgtg
gtcacggagtcggagctgacggtgcgccgggtcccgatcgagttcctggagatcgagctg
gcggtcctggaggagatgggcctcgaccacgaccgcaccccggagtacttcgccgacaac
ggccgtacccgcctggtggacctgaccgtgcgcccctccaagctggaggcgccgatcgac
aagatccacccgatgcccttcccgggcctgaacatcgacaacgtccccttcttcgcggcc
atcgcggcctcggcgcagggccagaccctcatccacgactgggtctacgacaaccgcgcc
atctacctcaccgacctgaaccgcctcggcggccgcctccagctcctggacccgcaccgc
gtcctggtcgagggccccacccgctggcgcgccgccgagatgatgtgcccgccggccctg
cgccccgcggtcgtcgtcctgctggcgatgatggccgccgagggcacgtcggtactgcgc
aacgtctacgtcatcaaccgcggctacgaggacctcgcggagcggctgaactcgatcggg
gcgcagatcgagatcttccgggacatctga

DBGET integrated database retrieval system