KEGG   Streptomyces coelicolor: SCO6160
Entry
SCO6160           CDS       T00085                                 

Gene name
SC1A9.24c
Definition
(RefSeq) bifunctional preprotein translocase subunit SecD/SecF
  KO
K12257  SecD/SecF fusion protein
Organism
sco  Streptomyces coelicolor
Pathway
sco02024  Quorum sensing
sco03060  Protein export
sco03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SCO6160 (SC1A9.24c)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SCO6160 (SC1A9.24c)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SCO6160 (SC1A9.24c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sco02044]
    SCO6160 (SC1A9.24c)
Secretion system [BR:sco02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SCO6160 (SC1A9.24c)
SSDB
Motif
Pfam: SecD_SecF Sec_GG MMPL SpoIIIAH ACR_tran ABC2_membrane
Other DBs
NCBI-GeneID: 1101601
Kitasato: SCO6160
UniProt: Q9ZBS8
Position
complement(6762662..6765049)
AA seq 795 aa
MKRSRPPSRSRSRTRSRSLNVRALVALAVMAGAVAIALTMPVRLGLDLRGGTQIVLETKS
TETTKADREATDRTVEVLRGRIDALGVAEPTIVRSGENRVVVELPGVQDPKKAADVLGRT
AQLTVHSVLGAAEKPADATEGRTETAEDGERVLPDESGQSLRLKAATLTGQDVKGADARF
DQQNGAGWTVTVDFKDSGSDRWAQVTGEAACNPAGDPTRRVAIVLDDKIISSPQVDPSVS
CGAGITGGSTQITGSFDDAEARELALLIKGGALPVPVETIEQRTIGATLGDEAIDAGAWA
AVIGTALTALFIIVVYRLMGALATVALLCYGLISYAALAAVGATLTLPGLAGFVLAIGMA
VDANVLVFERAREEQAARTRPSTRSALTAGFRSAFSAIADSNITTLIAAALLFFLASGPV
KGFGVTLGIGVLASMVSALVITRVLAEFAASRPAVFRRPRITGISSTGPVRDALLRRDPF
LMRRPRRWLAASLIVLVVAGSGILVRGLNFGIEFTGGRLIEYSTATQVDPDRARDALADA
GFPRAVVQSSGDGDLTVRTEELTDTEAATVTKAVAELGGETEKVRDELIGPSLGEELRRD
ALIALGLALAAQLAYLAVRFRLLFGTAAVGALAHDVVILVGVFAWLGKPIDGVFLAALLT
VIGYSVNDSVVLFDRIRELLGKERKAPFDRLTNDAILQTLPRTVNTGMGAVLILASLAIL
ADDSLTDFALALLIGVGVGTYSSVFTASPLAIELHNRDTGSRPGRRRGGRTRATGKSEKP
GKQVPTSRTERQEVR
NT seq 2388 nt   +upstreamnt  +downstreamnt
ttgaaacgctcccgtcccccttcccgctcccgttcccgtacgcggtcccgttccctgaac
gtccgcgccctcgtcgcgctggccgtgatggccggggccgtggccatcgccctgaccatg
ccggtccgcctggggctcgacctgcgcggcggcacccagatcgtcctggagaccaagtcg
accgagaccaccaaggccgaccgggaggccaccgaccgcaccgtggaggtgctgcgcggc
cgcatcgacgccctcggcgtcgccgagccgaccatcgtccgctccggcgagaaccgggtc
gtcgtcgagctgccgggcgtacaggacccgaagaaggccgccgacgtgctcggccgcacc
gcgcagctcaccgtccactcggtgctcggcgcggcggagaagcccgccgacgcgaccgag
ggcaggaccgagaccgccgaggacggcgagcgggtgctgccggacgagtccgggcagtcc
ctgcggctgaaggccgccacgctgaccggtcaggacgtcaagggcgccgacgcccgcttc
gaccagcagaacggcgccggctggaccgtcaccgtcgacttcaaggactccggcagcgac
cgctgggcgcaggtgaccggcgaggcggcctgcaacccggccggtgaccccacgcgccgg
gtcgccatcgtgctcgacgacaagatcatctcctcgccgcaggtcgacccctccgtgtcc
tgcggggcgggcatcaccggcggctccacgcagatcaccggctccttcgacgacgccgag
gcgcgcgaactggccctgctcatcaagggcggcgccctgccggtgccggtcgagaccatc
gagcagcgcaccatcggcgccaccctgggcgacgaggccatcgacgccggcgcctgggcc
gccgtcatcggcaccgcgctgaccgcgctgttcatcatcgtcgtctaccggctgatgggc
gccctcgcgaccgtggccctgctctgctacggcctgatctcctacgccgccctggccgcg
gtcggcgcgaccctgaccctgccgggcctggcgggcttcgtgctggcgatcggcatggcg
gtggacgccaacgtcctggtcttcgagcgggcccgcgaggaacaggcggcccggacccgt
cccagtacgcgctccgcgctgaccgccggtttccgcagcgccttcagcgcgatcgccgac
tccaacatcaccacgctgatcgccgccgccctgctgttcttcctggcctccggcccggtc
aagggcttcggcgtcaccctcggcatcggtgtgctggcctcgatggtcagcgccctggtg
atcacccgggtgctcgccgagttcgccgcgagccgcccggcggtcttccgccgcccccgt
atcaccggcatctcctcgaccggcccggtccgtgacgccctgctgcgccgcgacccgttc
ctgatgcgccggccgcgccgctggctggcggcctcgctgatcgtccttgtggtggcgggc
tccggcatcctggtgcggggcctgaacttcggcatcgagttcaccggcgggcggctcatc
gagtactccaccgccacccaggtcgatcccgaccgggcgcgggacgccctggccgacgcg
ggcttcccgcgcgccgtcgtccagtcctccggcgacggcgacctcacggtgcgcacggag
gagctgaccgacaccgaggcggcgaccgtcacgaaggccgtcgccgaactgggcggcgag
acggagaaggtccgcgacgagctgatcggcccgagcctcggcgaggagctgcgccgggac
gccctgatcgccctcggcctggcgctggccgcgcagctggcgtacctggcggtccggttc
cgcctgctgttcggcacggcggcggtcggcgcgctcgcccacgacgtggtcattctggtc
ggtgtgttcgcctggctgggcaagccgatcgacggggtgttcctggcggcgctgctgacc
gtgatcggctactcggtgaacgactcggtggtgctcttcgaccgcatccgggaactgctg
ggcaaggagcggaaggcaccgttcgaccggctcaccaacgacgcgatcctgcagaccctg
ccgcgcacggtcaacaccggcatgggcgcggtgctcatcctggcctcgctggcgatcctg
gccgacgactcgctcaccgacttcgcgctcgcgctgctgatcggcgtgggggtcggcacg
tactcgtcggtcttcaccgcctctcccctggccatcgagctgcacaaccgcgacaccggt
tcccgccccgggcgccgcaggggcggccggacccgcgccacggggaagtccgagaagccg
gggaagcaggtgcccacgagccgcacggaacggcaggaggtccgctag

DBGET integrated database retrieval system