KEGG   Streptomyces coelicolor: SCO6187Help
Entry
SCO6187           CDS       T00085                                 

Gene name
SC2G5.08
Definition
(RefSeq) bifunctional synthase/transferase
  KO
K03272  D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC:2.7.1.167 2.7.7.70]
Organism
sco  Streptomyces coelicolor
Pathway
sco00540  Lipopolysaccharide biosynthesis
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    SCO6187 (SC2G5.08)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sco01005]
    SCO6187 (SC2G5.08)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.167  D-glycero-beta-D-manno-heptose-7-phosphate kinase
     SCO6187 (SC2G5.08)
   2.7.7  Nucleotidyltransferases
    2.7.7.70  D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase
     SCO6187 (SC2G5.08)
Lipopolysaccharide biosynthesis proteins [BR:sco01005]
 Unusual sugar
  SCO6187 (SC2G5.08)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like PfkB Phos_pyr_kin FAD_syn
Motif
Other DBs
NCBI-GeneID: 1101628
NCBI-ProteinID: NP_630290
Kitasato: SCO6187
UniProt: Q9Z5B5
Position
6792478..6793869
Genome map
AA seq 463 aa AA seqDB search
MTGPMAVRTDRTPLVVVGDALLDRDLTGTADRLAPDAPVPVVQECAERIRPGGAALAAYL
AARDGREVTLIAGVGEDPAGLALRELLAPWLKLIPLPLTGTVPEKTRVLAQDRPVVRLDR
GGGRVREATDEARDALGCARAVLVSDYGRGAADALRDVLAARPPLVWDPHPRGGPPVPGT
RLVTPAEKEAHGFAPSEGRPGGGLRAAALNAAALVRDWRVAAVTVTLGSRGALLSYGEHP
LLVPAPAAHHGDSCGAGDRFAATAAGLLADGALVGEAVEGAVGAATAFVAAGGAAAVPPA
GSERALAALPDTDDPGALAARIRAEHGTVVAAGGCFDLLHAGHVGLLQAARRLGDCLVVC
VNSDASVRRGKGGGRPVNPLADRVRVLRALACVDAVAVFDEDTPERLLGELRPDVWVKGG
DYAGADLPEAGLLKEWGGQAVLLPYLDGRSSTALLARAAEGAR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggacccatggccgtcaggacggacaggacccccctggtcgtggtcggcgacgcg
ctgctcgaccgcgacctgaccggcaccgccgaccggctcgcaccggacgcgcccgtcccg
gtcgtccaggagtgcgccgagcggatccgcccgggcggcgccgccctcgccgcgtacctc
gccgcccgcgacggccgcgaggtcacgctgatcgcgggcgtgggcgaggacccggccggt
ctcgccctgcgcgaactgctcgccccctggctgaagctgatcccgttgccgctgaccggc
acggtgccggagaagacccgggtcctcgcccaggaccgccccgtggtccgcctcgaccgc
ggcggcggccgggtccgcgaggcgacggacgaggcccgcgacgcgctgggttgcgcccgt
gccgtcctggtctccgactacggccgcggcgcggcggacgccctgcgcgacgtgctcgcc
gcgcgcccgccgctggtctgggacccgcacccgcgcggtggaccgccggttcccggcacc
cgcctggtgacgcccgccgagaaggaggcgcacggcttcgcgccgtccgagggccgcccg
gggggcgggctgcgggccgccgcgctcaacgccgccgcactggtacgcgactggcgggtg
gccgccgtgacggtcaccctcggctcgcgcggcgcgctcctgtcctacggcgaacacccc
cttctcgtccccgcgcccgccgcccaccacggcgactcctgcggcgcgggggaccggttc
gcggccaccgcggccgggctgctcgccgacggcgcgctggtgggcgaggccgtcgagggc
gcggtgggcgccgccacggccttcgtcgccgcgggcggcgcggccgccgtgccgccggcc
ggctccgaacgggcgctcgccgcactccccgacaccgacgaccccggcgccctggccgcc
cggatccgcgccgaacacggcacggtcgtcgccgccggcggctgcttcgacctgctgcac
gccggacacgtcggcctcctccaggccgcccggcggctcggcgactgcctggtcgtctgc
gtcaactccgacgcctcggtccggcgcggcaagggcggcggccgccccgtcaaccccctc
gccgaccgcgtccgcgtcctgcgcgccctcgcctgcgtcgacgcggtcgccgtcttcgac
gaggacacccccgaacgcctcctcggcgaactgcgccccgacgtctgggtcaagggcggc
gactacgccggcgccgacctccccgaggccgggctcctgaaggagtggggcggacaggcg
gtcctcctgccctacctcgacggccgctcctccaccgccctgctggcccgcgccgccgag
ggagcccgatga

DBGET integrated database retrieval system