KEGG   Streptomyces coelicolor: SCO6691Help
Entry
SCO6691           CDS       T00085                                 

Gene name
SC4C6.01, SC6G3.07
Definition
(RefSeq) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00562  Inositol phosphate metabolism
sco00564  Glycerophospholipid metabolism
sco00565  Ether lipid metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SCO6691 (SC4C6.01)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO6691 (SC4C6.01)
   00565 Ether lipid metabolism
    SCO6691 (SC4C6.01)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SCO6691 (SC4C6.01)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sco02042]
    SCO6691 (SC4C6.01)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     SCO6691 (SC4C6.01)
Bacterial toxins [BR:sco02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   SCO6691 (SC4C6.01)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-GeneID: 1102130
NCBI-ProteinID: NP_733712
Kitasato: SCO6691
UniProt: Q8CJM0
Position
7440399..7442462
Genome map
AA seq 687 aa AA seqDB search
MAEVNRRRFLQLAGATTAFSALSASIDRAAALPANHRSGSIEDVEHIVVLMQENRSFDHY
FGTLRGVRGFGDPHPVRLDDGRSVWHQRKGDGTEVLPFHPEADDLGMQFLEGLPHGWSDG
QDAYHDAKYDRWLPAKGTTTMAYLTREDIPFHYALADTFTVCDAYHCSFIGSTDPNRYYL
WSGHTGNDGAGGGPVLGNDELGYDWTTYPERLEAAGVSWKIYQDVGDGLDAAGHWGWIDD
AYRGNYGDNSLLYFNKYRNAKPGDPLYDKARTGTDAKRGEGYFDRLRADVKAGKLPEISW
IAAPEAFSEHSNWPSNYGAWYISQVLDALTSNPKVWAKTALFITYDENDGFFDHVVPPLP
PKSAAQGRSTVDVSLDVFEGSAKHREGFYGLGPRVPMLVVSPWSKGGFVCSETFDHTSVI
RFMERRFGVHEPNISPWRRAVCGDLTSAFDFSRTDSRPARLPDTDAYEPPDRERHPDYRP
TPPADPGMPRQERGTRPTRPLRYAPHVDGAVDTAAGKFTLAFASGPRAGAAFLVTSGNRT
DGPWTYTTEAGKDIADTWNSAYSGGSYDLTVHGPAGFLRVFRGANEVAGPAGPEVTARHR
GDDLRLTLTHTGTGTVRLRIANAHDGRTRSVTVRPGATVHHTVGLARSRRWYDVTVTSET
APAFLRRFAGHVENGRPGTSDPAIVTD
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtgaaccggcgcagattcctccaactggcgggcgccaccacggcgttcagt
gccctgtccgcgagcatcgaccgggccgcggcactcccggcgaaccaccgatcggggtcg
atcgaggacgtcgagcacatcgtcgtcctgatgcaggagaaccgttccttcgaccactac
ttcggcacactgcgcggggtccgcggcttcggcgacccgcatccggtgcgactggacgac
ggcaggtcggtgtggcaccagcgcaagggcgacggcaccgaggtactacccttccacccg
gaggccgacgacctcggtatgcagttcctcgaagggctcccgcacggctggtccgacggc
caggacgcctaccacgacgccaagtacgaccgctggctgcccgccaagggcaccaccacc
atggcgtacctgacccgcgaggacatccccttccactacgcgctcgccgacaccttcacc
gtctgcgacgcctaccactgctccttcatcggctccaccgaccccaaccgctactacctg
tggtcggggcacacgggcaacgacggcgcgggcggcggcccggtcctcggcaacgacgaa
ctcggctacgactggacgacgtaccccgagcgcctggaggcggccggggtctcctggaag
atctaccaggacgtcggcgacggcctcgacgcggccggccactggggctggatcgacgac
gcctaccggggcaactacggcgacaactccctgctgtacttcaacaagtaccggaacgcg
aagcccggcgacccgctgtacgacaaggcccgcaccggcaccgacgcgaagcgcggcgag
ggctacttcgaccggctccgtgccgacgtcaaggcgggcaagctgccggagatctcctgg
atagccgccccggaggcattctccgagcactccaactggccgtcgaactacggcgcctgg
tacatctcccaggtcctggacgcgctcacctccaacccgaaggtgtgggcgaagaccgcc
ctgttcatcacgtacgacgagaacgacggcttcttcgaccacgtggtgccgccgctgccg
ccgaagtccgccgcgcagggccggtccaccgtcgacgtctccctggacgtcttcgagggc
agcgccaagcaccgcgagggcttctacgggctcggcccgcgcgtgcccatgctggtcgtc
tcgccgtggagcaagggcggcttcgtctgctccgagaccttcgaccacacctcggtcatc
cgcttcatggaacgccgcttcggcgtccacgagccgaacatctcaccctggcggcgcgcc
gtctgcggcgacctgacctccgccttcgacttctcccgcacggacagccgcccggcccgg
ctgccggacaccgacgcctacgagccgccggaccgcgaacgccaccccgactaccgtccg
acgccgcccgcggaccccggcatgccccggcaggaacgcgggacacgccccacccggccg
ctgcgctacgccccgcacgtcgacggcgccgtggacacggcggccgggaagttcacgctg
gccttcgcctccgggccccgggccggtgccgccttcctcgtcacctccggcaaccgcacc
gacggcccctggacgtacaccaccgaggccggcaaggacatcgcggacacctggaactcg
gcctactccggcggctcctacgacctgaccgtgcacggcccggccggcttcctgcgggtc
ttccggggtgccaacgaggtcgccggacccgccgggcccgaggtcaccgcacggcaccgc
ggcgacgacctccggctgaccctcacccacaccgggaccggcaccgtccggctccggatc
gcgaacgcccacgacggccgcacccggtccgtcaccgtccgccccggcgccaccgtgcac
cacaccgtcggcctcgcgcgcagccggcgctggtacgacgtgacggtcacctccgagacc
gccccggccttcctgcgccgcttcgccgggcacgtggagaacggccggccggggaccagc
gacccggcgatcgtcacggactga

DBGET integrated database retrieval system