KEGG   Streptomyces coelicolor: SCO6809Help
Entry
SCO6809           CDS       T00085                                 

Gene name
SC1A2.18c
Definition
(RefSeq) integral membrane transport protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 1102248
NCBI-ProteinID: NP_630881
Kitasato: SCO6809
UniProt: Q9L223
Position
complement(7571107..7572336)
Genome map
AA seq 409 aa AA seqDB search
MSYRSMASPAAALNQPTRPRAALPALCLTQITSWGIVYYAFPVLNPQITMATGWSATATT
AAFSAALLMSAVAGIRIGRILDARGPRTVMTVGSVVGTVSLVIIASAPNLTVFTAGWLLA
GFAMASTFYQPAFAALTRWWAPNHVRALTIVTLAGGLASTVFAPLTAQLANHFSWRHTYL
LLALVLATVTVPVHAYALRGPWPPAPPPSTTGETASTTVITRSRPFLLLATALTLSAFAT
YAVVITLVPLLLDRGYTAAEAAWALGLGGAGQTLGRTLYAPLARRSSPALRAAVLIGMGG
VTTAAFALIPGPYGLLAALAVIAGTVRGNLTLLQATAITDRWGAHRYGRLSGLLAAPTTT
ASALAPFAGTALAAPLGGYPRLFSALALASAAAALIAWYTAPTPAARKP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccgctccatggcctcccccgcggccgccctcaaccagccgacgcggccgcgg
gcggccctccccgccctgtgtctgacccagatcaccagctggggcatcgtctactacgcc
tttcccgtcctcaatccacagatcaccatggccaccggctggagcgccactgcgaccaca
gccgcgttctccgctgccttgctgatgtccgccgttgccggcattcgcatcggccgcatc
ctcgatgcccgaggccctcgcacagtcatgaccgtcggttcggtggttggaacagtcagc
ttggtcatcatcgccagcgcccccaacctgaccgtgttcaccgccggatggctactggcg
gggttcgccatggcctccaccttctaccagcccgccttcgcggcattgacccgctggtgg
gcccccaaccacgtacgtgcgctgacgatcgtcactctcgccggcggcctggcatcgacc
gtcttcgcacccctcaccgcccagttggccaaccacttcagttggcggcacacctacctg
ctgctggctctcgtcctggccacagtgacggtgcccgtccacgcctacgcactgcgcggc
ccatggccccccgccccgcccccaagcacaacaggtgagaccgcgtctacgaccgtcatc
acacgtagccgtcccttccttcttctggcaacggctctgactctttcggcgttcgcgaca
tacgccgtcgtcatcacactcgtccccctgctactcgaccgcggctacaccgctgccgaa
gccgcctgggctctggggctgggcggagccggccagaccctcggccgcaccctctacgcc
ccactagcccgccgcagctcccccgctctgcgcgcagcagtgctgatcggcatgggaggg
gtgaccaccgcagccttcgcgctcattcccggaccctacgggctgcttgcggcgctggcc
gtcatcgccggtactgtccgcggcaacctgaccctgctgcaggccaccgccatcacagac
cgatggggcgcccatcgctacggccgcctctccggccttctcgccgcccccacgacgacc
gcctccgcactcgctccgttcgctggcaccgccctggccgcacctctcggcggctacccc
cgcctgttctccgctctcgcgttggcctcggccgccgcagcgctcatcgcctggtacacg
gcaccgactccggctgccagaaagccatag

DBGET integrated database retrieval system