KEGG   Staphylococcus cohnii: BZ166_02665Help
Entry
BZ166_02665       CDS       T05008                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scoh  Staphylococcus cohnii
Pathway
scoh00071  Fatty acid degradation
scoh00072  Synthesis and degradation of ketone bodies
scoh00280  Valine, leucine and isoleucine degradation
scoh00310  Lysine degradation
scoh00362  Benzoate degradation
scoh00380  Tryptophan metabolism
scoh00620  Pyruvate metabolism
scoh00630  Glyoxylate and dicarboxylate metabolism
scoh00640  Propanoate metabolism
scoh00650  Butanoate metabolism
scoh00900  Terpenoid backbone biosynthesis
scoh01100  Metabolic pathways
scoh01110  Biosynthesis of secondary metabolites
scoh01120  Microbial metabolism in diverse environments
scoh01130  Biosynthesis of antibiotics
scoh01200  Carbon metabolism
scoh01212  Fatty acid metabolism
scoh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scoh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZ166_02665
   00630 Glyoxylate and dicarboxylate metabolism
    BZ166_02665
   00640 Propanoate metabolism
    BZ166_02665
   00650 Butanoate metabolism
    BZ166_02665
  Lipid metabolism
   00071 Fatty acid degradation
    BZ166_02665
   00072 Synthesis and degradation of ketone bodies
    BZ166_02665
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BZ166_02665
   00310 Lysine degradation
    BZ166_02665
   00380 Tryptophan metabolism
    BZ166_02665
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BZ166_02665
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BZ166_02665
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BZ166_02665
Enzymes [BR:scoh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BZ166_02665
Exosome [BR:scoh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BZ166_02665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQM40681
Position
complement(539146..540288)
Genome map
AA seq 380 aa AA seqDB search
MNEAVIIAAKRTAFGKYGGKLRHLEPELLLQPLFNYLKNNFPAIVNNIDDVILGNVIGNG
GNIARKALLEAGLNQQVPGVTVDRQCGSGLEAVNQACRMIQAGAGSIYIAGGVESTSRAP
WKIKRPQSVYDTHLPEFYERASFAPQGQDPSMIQAAENVAERYGISRFEQDEFAWHSHQK
TLDAYNHRKITQEITPLMIKGETFQQDESIKPKLTQQTLNRLKPLLPNGSITAGNCCMKN
DGAVLLLVMEKTLAKAYGIHSGLSFIDQVTIGVDPNILGIGPVPAIEKLLAKQQLSLNDI
DAIELNEAFASQVLASQQALNVPAEKLNIYGGAIATGHPYGASGAALVTRLFYMEHKHRT
IATMGIGGGMGNATLFERWS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagcggtaattatagcagcgaaacgtacagcatttgggaagtatggtgggaaa
ttgagacatttagaacctgaattattattacagccactattcaattatttgaaaaataac
ttccctgcaattgttaataatatagatgacgtgattttaggtaatgttatcggaaatgga
ggtaatattgcgcgaaaggcacttttagaagctggattaaatcaacaagtgccaggtgtg
acggttgatcgccaatgtggttcgggattagaggctgtaaatcaagcctgtcgcatgata
caagcaggtgcagggtcaatatacattgcaggtggcgtggaaagtacaagcagagcaccc
tggaagattaagcggccacaatctgtatatgacacacatttaccagaattttatgaaaga
gcatcatttgcacctcaaggccaagatccatctatgatacaagcagctgaaaatgttgca
gaaagatatggtatatcaagatttgaacaagatgaattcgcatggcacagtcatcaaaaa
acgcttgatgcatataaccatcgtaagattactcaagagataacaccactgatgattaaa
ggagaaacatttcaacaagatgaaagtattaaacctaaattaacgcaacaaacgttaaat
cgattaaagccattattaccaaacgggagcattactgctggcaactgttgtatgaaaaat
gacggtgccgtactactacttgtcatggaaaaaacacttgctaaagcatatggcatacac
agtggattatcattcattgaccaagtaactataggtgtagacccaaatatacttggtatt
ggtcctgtgcctgctatagaaaaactattagcaaaacagcaattgtctttaaatgatatc
gatgctatagaattaaatgaagcttttgcatcacaagtgttagcaagccaacaagcttta
aacgtaccagctgaaaaattaaatatttatggtggcgcgatagctactggacatccttat
ggcgcaagtggtgctgcacttgttacacggctattctatatggaacataaacataggaca
attgcaactatgggtattggaggaggtatgggcaatgccacattatttgaaagatggtca
tga

DBGET integrated database retrieval system