KEGG   Staphylococcus cohnii: BZ166_06250Help
Entry
BZ166_06250       CDS       T05008                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scoh  Staphylococcus cohnii
Pathway
scoh00071  Fatty acid degradation
scoh00072  Synthesis and degradation of ketone bodies
scoh00280  Valine, leucine and isoleucine degradation
scoh00310  Lysine degradation
scoh00362  Benzoate degradation
scoh00380  Tryptophan metabolism
scoh00620  Pyruvate metabolism
scoh00630  Glyoxylate and dicarboxylate metabolism
scoh00640  Propanoate metabolism
scoh00650  Butanoate metabolism
scoh00900  Terpenoid backbone biosynthesis
scoh01100  Metabolic pathways
scoh01110  Biosynthesis of secondary metabolites
scoh01120  Microbial metabolism in diverse environments
scoh01130  Biosynthesis of antibiotics
scoh01200  Carbon metabolism
scoh01212  Fatty acid metabolism
scoh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZ166_06250
   00630 Glyoxylate and dicarboxylate metabolism
    BZ166_06250
   00640 Propanoate metabolism
    BZ166_06250
   00650 Butanoate metabolism
    BZ166_06250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BZ166_06250
   00072 Synthesis and degradation of ketone bodies
    BZ166_06250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BZ166_06250
   00310 Lysine degradation
    BZ166_06250
   00380 Tryptophan metabolism
    BZ166_06250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BZ166_06250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BZ166_06250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BZ166_06250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scoh04147]
    BZ166_06250
Enzymes [BR:scoh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BZ166_06250
Exosome [BR:scoh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BZ166_06250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQM41182
Position
1334399..1335553
Genome map
AA seq 384 aa AA seqDB search
MKKIAIVSAKRTPIGKFRGKLSNYTAVELGTKSLEAAMSAINLKPEMIEQVIYGNVLQAG
NGQNPARQVSINAGVPNTTPAMTINEVCGSGLKSIILGKQQIQLGEAKVVAVGGIESMTN
APQILLNEDAAPVESFMHDGLTDAFLNVPMGITAEKIAEKYNVTRAQQDEFANDSQHKAA
QASSSGKFDNEIVPLTDSEGQLMTADEGIRGNSSVEKLSTLKTIFKEDGTVTGGNASSIN
DGASTIILMDVDYAKQEGFEIIATLGEHAEIGCDPAYMGYAPYHAVTELLAKAKKDINDI
EVVEMTEAFAAQSIPVKNNLGIHPDKLNLYGGAIAIGHPIGASGTRLVTTLVNILSQENK
QNGIATACIGGGLGIALYVEKGDA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagcaatcgtaagtgccaagcggacacctataggaaaattcagaggaaaa
ttaagtaattatactgcagtagaattaggtacaaaatcgttagaagctgcaatgtcagca
attaatctcaaacctgaaatgatagagcaggtcatttatggcaatgtacttcaagctgga
aatggtcaaaatcctgcgcgacaagttagtatcaacgcaggtgtacctaatactacacct
gcgatgactattaatgaagtctgtggttcaggattgaaatcgattatattaggcaaacaa
caaattcaattaggtgaagcaaaagtagtagcagtaggcggcattgaaagtatgaccaat
gctccccaaatattacttaatgaagatgcagcgccagtagaaagttttatgcatgacggt
ttaactgatgcatttctaaatgtaccaatgggcattactgcagagaaaatagcagaaaaa
tataatgttacacgagcacaacaagatgaatttgcgaatgactcgcaacataaagcggca
caagcttccagctcaggtaaatttgataatgaaattgttcccttaacagatagtgaaggc
caattaatgacagcagatgaaggtattcgtggaaatagcagtgttgaaaaattaagcaca
ttaaaaacaatatttaaagaagatggtactgtcacaggagggaatgcttcaagtatcaac
gatggcgcatcaacaattattttgatggatgtagattatgcaaaacaagaaggatttgaa
attattgcaacattaggtgaacacgcggaaattggctgtgatcctgcctatatggggtac
gcaccgtaccatgcagtgacggaattattagcaaaagctaagaaagatataaatgatatt
gaagttgtagaaatgacagaagcatttgctgctcaaagtataccggttaaaaataatttg
gggatacatcctgataagcttaacttatacggtggtgctattgctataggtcatcctata
ggtgcgagtggaacgcggttggtgacaactttagtgaatatcttatcgcaagaaaataaa
caaaatggtattgcaactgcatgtattggtggcggtttaggtattgcattatatgtagaa
aagggggatgcatga

DBGET integrated database retrieval system