KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_0884Help
Entry
SCRE_0884         CDS       T02833                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Pathway
scon00071  Fatty acid degradation
scon00072  Synthesis and degradation of ketone bodies
scon00280  Valine, leucine and isoleucine degradation
scon00310  Lysine degradation
scon00362  Benzoate degradation
scon00380  Tryptophan metabolism
scon00620  Pyruvate metabolism
scon00630  Glyoxylate and dicarboxylate metabolism
scon00640  Propanoate metabolism
scon00650  Butanoate metabolism
scon00900  Terpenoid backbone biosynthesis
scon01100  Metabolic pathways
scon01110  Biosynthesis of secondary metabolites
scon01120  Microbial metabolism in diverse environments
scon01130  Biosynthesis of antibiotics
scon01200  Carbon metabolism
scon01212  Fatty acid metabolism
scon02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCRE_0884
   00630 Glyoxylate and dicarboxylate metabolism
    SCRE_0884
   00640 Propanoate metabolism
    SCRE_0884
   00650 Butanoate metabolism
    SCRE_0884
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCRE_0884
   00072 Synthesis and degradation of ketone bodies
    SCRE_0884
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCRE_0884
   00310 Lysine degradation
    SCRE_0884
   00380 Tryptophan metabolism
    SCRE_0884
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCRE_0884
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCRE_0884
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCRE_0884
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scon04147]
    SCRE_0884
Enzymes [BR:scon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SCRE_0884
Exosome [BR:scon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCRE_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III SpoVAD Chordopox_A33R
Motif
Other DBs
NCBI-ProteinID: AGU72725
Position
complement(900546..901724)
Genome map
AA seq 392 aa AA seqDB search
MKEAVIVSAVRTPLGSFGGSLKNISAVDLGSLVIKSAIERAHLKAEQIDEVIMGNVLAAG
LGQNVARQMSVNAGIPVSSPAFTVNKVCGSGLKTVQLAAQAILCGDADIIVAGGAENMSQ
APYVLQGQRWGSRMGDTKVIDTMLRDGLTDAFGDFHMGITAENVAEQYDISREVQDAFAV
QSQQRAVAAIEAGRFKEEIVPVIIPQRKGEPIVFDTDEFPRKDASLEGLAKLRPVFKEGG
TVTAGNASGINDGAAAVVVMSSEKAKELGIPVLATIKSYASAGLDPKIMGCGPIYASRKA
LEKGGFTTEDLDLIESNEAFASQACAVCKELNLDPEKVNVNGGAIALGHPIGASGCRILV
TLLHEMEKRDAKRGLATLCIGGGMGTAVIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagtgattgtatcagcagttcgtacaccattaggttcttttggtggaagt
ttgaaaaatatttcagctgttgatttgggaagtttggttattaaaagtgcgattgaacga
gcacatttgaaagcagaacaaattgatgaagtgattatgggaaatgtgttggcagcagga
ctagggcaaaatgtagcacgtcaaatgagtgtcaatgcgggtattccagtctcttctcca
gcctttacagtgaataaggtatgtggttcaggactgaaaacagttcaattagctgcccaa
gcaattttatgtggagatgcagatattattgtagcaggtggtgcagaaaatatgagtcag
gcaccatacgttcttcaaggtcagcgttggggctctcgtatgggagatacaaaagtgatt
gacactatgttacgcgacggtctgactgacgcttttggtgatttccatatgggaatcaca
gctgaaaatgttgctgaacagtatgatatttctcgtgaagtccaagatgcttttgctgtt
cagtcacaacaacgtgctgtggcagctattgaagctggacgtttcaaagaagaaatcgtt
ccagtgattattccacagagaaaaggtgagccaattgtttttgatacggatgaatttcca
agaaaagatgcctcactagaaggtttggctaaattacgccctgtctttaaagaaggcgga
acggtcacagctggtaatgcttctggtatcaacgatggagcggcagcagttgttgtcatg
agttcagaaaaagcgaaagagctaggcattcctgttttagcaaccataaaatcctatgca
agtgcaggattagatccgaaaatcatgggttgcggaccaatttatgcttctcgtaaagca
cttgaaaagggtggctttacaactgaagatctcgatttgattgaatccaatgaagcattt
gcatcgcaagcatgtgctgtttgtaaggagttaaatcttgatccggaaaaagtaaacgta
aacggtggtgccattgcacttggtcatccaattggagcatcaggctgccgtattctggtt
actttgttgcatgaaatggaaaaacgcgatgctaaacgtggtcttgcaactctttgtatc
ggaggaggaatgggcacagcagttattgtagaacgttaa

DBGET integrated database retrieval system