KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_1699Help
Entry
SCRE_1699         CDS       T02833                                 

Gene name
rrmA
Definition
(GenBank) ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Brite
KEGG Orthology (KO) [BR:scon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:scon03009]
    SCRE_1699 (rrmA)
Enzymes [BR:scon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     SCRE_1699 (rrmA)
Ribosome biogenesis [BR:scon03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SCRE_1699 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_23 MTS Methyltransf_32 Methyltransf_8 Methyltransf_18 Ubie_methyltran CMAS zf-Di19 NodS Methyltransf_9 PrmA PCMT MetW RNase_T Toxin_ToxA
Motif
Other DBs
NCBI-ProteinID: AGU73493
Position
1751429..1752265
Genome map
AA seq 278 aa AA seqDB search
MKPKLKRFETANLFACPFCQQALFLAENSLKCNNKHSFDLAKFGYVNLAPQVKQSKDYDK
TNFQNRQLILEAGFYQPILNKLLDILTSLPQHANLLDIGCGEGYYARNLQAQMTDKHIYA
FDLSKESIQLAAKSDHSMAVNWFVGDLAHLSIQDTSMDVILDIFSPANYQEFQRVLRKNG
LLIKVIPNSQHLQEIRSIVAEQLTNTNYSNQKIIEHFKKSFTIADSYDVVSTFSLKENEK
MALLKMTPLLFNMDIENINWSSLHNVTIAAKILVGQEK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaaactcaaacgttttgaaacagctaatctttttgcttgccctttttgccag
caagccttgtttttagcagaaaatagtcttaaatgtaacaataagcattcctttgatcta
gcaaaattcggttatgtcaatctggcaccacaggtgaagcagtcaaaagactacgataaa
accaactttcaaaatcgacaattgattctcgaagcaggattctatcagccaattttaaac
aaactgttagatattttaacttctttgccacagcatgctaatctgttagatattggctgc
ggagaaggttactatgctcgaaacctgcaagcacagatgactgataaacacatctacgcg
ttcgatttatcaaaagaatcgattcagctagcagccaaaagcgaccacagcatggcagta
aattggtttgttggagatctggcgcatctttccattcaagataccagtatggatgtgatt
ttggatattttctctcctgccaattatcaagaatttcaacgcgtattgcggaaaaacggc
ttgcttattaaggttattcctaacagccaacatttgcaagaaattcgtagtatcgttgcc
gagcagttaacaaacacaaattattccaatcaaaaaatcattgaacactttaagaaatcc
tttaccattgcagactcctatgatgttgttagcactttttcactgaaggaaaatgaaaaa
atggctctgctgaaaatgactccgcttcttttcaatatggatattgaaaacatcaactgg
tcatccttacacaatgttaccattgctgcaaagattttggtcggtcaagaaaaataa

DBGET integrated database retrieval system