KEGG   Streptococcus constellatus subsp. pharyngis C818: SCR2_0884Help
Entry
SCR2_0884         CDS       T02834                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scos  Streptococcus constellatus subsp. pharyngis C818
Pathway
scos00071  Fatty acid degradation
scos00072  Synthesis and degradation of ketone bodies
scos00280  Valine, leucine and isoleucine degradation
scos00310  Lysine degradation
scos00362  Benzoate degradation
scos00380  Tryptophan metabolism
scos00620  Pyruvate metabolism
scos00630  Glyoxylate and dicarboxylate metabolism
scos00640  Propanoate metabolism
scos00650  Butanoate metabolism
scos00900  Terpenoid backbone biosynthesis
scos01100  Metabolic pathways
scos01110  Biosynthesis of secondary metabolites
scos01120  Microbial metabolism in diverse environments
scos01130  Biosynthesis of antibiotics
scos01200  Carbon metabolism
scos01212  Fatty acid metabolism
scos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCR2_0884
   00630 Glyoxylate and dicarboxylate metabolism
    SCR2_0884
   00640 Propanoate metabolism
    SCR2_0884
   00650 Butanoate metabolism
    SCR2_0884
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCR2_0884
   00072 Synthesis and degradation of ketone bodies
    SCR2_0884
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCR2_0884
   00310 Lysine degradation
    SCR2_0884
   00380 Tryptophan metabolism
    SCR2_0884
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCR2_0884
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCR2_0884
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCR2_0884
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scos04147]
    SCR2_0884
Enzymes [BR:scos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SCR2_0884
Exosome [BR:scos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCR2_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III SpoVAD Chordopox_A33R
Motif
Other DBs
NCBI-ProteinID: AGU74481
Position
complement(900775..901953)
Genome map
AA seq 392 aa AA seqDB search
MKEAVIVSAVRTPLGSFGGSLKNISAVDLGSLVIKSAIERAHLKAEQIDEVIMGNVLAAG
LGQNVARQMSVNAGIPVSSPAFTVNKVCGSGLKTVQLAAQAILCGDADIIVAGGAENMSQ
APYVLQGQRWGSRMGDTKVIDTMLRDGLTDAFGDFHMGITAENVAEQYDISREVQDAFAV
QSQQRAVAAIEAGRFKEEIVPVIIPQRKGEPIVFDTDEFPRKDASLEGLAKLRPVFKEGG
TVTAGNASGINDGAAAVVVMSSEKAKELGIPVLATIKSYASAGLDPKIMGCGPIYASRKA
LEKGGFTTEDLDLIESNEAFASQACAVCKELNLDPEKVNVNGGAIALGHPIGASGCRILV
TLLHEMEKRDAKRGLATLCIGGGMGTAVIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagtgattgtatcagcagttcgtacaccattaggttcttttggtggaagt
ttgaaaaatatttcagctgttgatttgggaagtttggttattaaaagtgcgattgaacga
gcacatttgaaagcagaacaaattgatgaagtgattatgggaaatgtgttggcagcagga
ctagggcaaaatgtagcacgtcaaatgagtgtcaatgcgggtattccagtctcttctcca
gcctttacagtgaataaggtatgtggttcaggactgaaaacagttcaattagctgcccaa
gcaattttatgtggagatgcagatattattgtagcaggtggtgcagaaaatatgagtcag
gcaccatacgttcttcaaggtcagcgttggggctctcgtatgggagatacaaaagtgatt
gacactatgttacgcgacggtctgactgacgcttttggtgatttccatatgggaatcaca
gctgaaaatgttgctgaacagtatgatatttctcgtgaagtccaagatgcttttgctgtt
cagtcacaacaacgtgctgtggcagctattgaagctggacgtttcaaagaagaaatcgtt
ccagtgattattccacagagaaaaggtgagccaattgtttttgatacggatgaatttcca
agaaaagatgcctcactagaaggtttggctaaattacgccctgtctttaaagaaggcgga
acggtcacagctggtaatgcttctggtatcaacgatggagcggcagcagttgttgtcatg
agttcagaaaaagcgaaagagctaggcattcctgttttagcaaccataaaatcctatgca
agtgcaggattagatccgaaaatcatgggttgcggaccaatttatgcttctcgtaaagca
cttgaaaagggtggctttacaactgaagatctcgatttgattgaatccaatgaagcattt
gcatcgcaagcatgtgctgtttgtaaggagttaaatcttgatccggaaaaagtaaacgta
aacggtggtgccattgcacttggtcatccaattggagcatcaggctgccgtattctggtt
actttgttgcatgaaatggaaaaacgcgatgctaaacgtggtcttgcaactctttgtatc
ggaggaggaatgggcacagcagttattgtagaacgttaa

DBGET integrated database retrieval system