KEGG   Spiroplasma corruscae: SCORR_v1c00080Help
Entry
SCORR_v1c00080    CDS       T05302                                 

Gene name
tmk
Definition
(GenBank) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
scou  Spiroplasma corruscae
Pathway
scou00240  Pyrimidine metabolism
scou01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scou00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCORR_v1c00080 (tmk)
Enzymes [BR:scou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     SCORR_v1c00080 (tmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 AAA_17 dNK AAA_18 APS_kinase AAA_33 KTI12 Torsin AAA_22 AAA_31 NTPase_1 SRP54 TIR_2 ArsA_ATPase CbiA AAA_30 NB-ARC Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ASP27783
UniProt: A0A222ENB6
Position
10070..10705
Genome map
AA seq 211 aa AA seqDB search
MLFISLEGIDGSGKTTISKMIKDNLSQKGYKVLLTREPGGEIFAEDIRQMILDKKNIITP
WTETLLYIAARKQHLDKVVIPALKSGTIVICDRFMDSTSAYQGYARNIGMTEIDEVQNIV
LGSTKPDLTIFFDITPNEAHIRLLKRKRKPDRLESENALFHEAVYEGYQILISENTDRIK
VVDSRKPINEVLQQVDFLINDALNQRMKKND
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgctttttatatcacttgaaggaattgacggttctggtaagacaacaatatcaaaaatg
atcaaggataatttgtctcaaaaaggttataaagttttgttaacaagagaacctggtggg
gaaatttttgcagaggatataagacaaatgatattagacaaaaaaaatataatcacccct
tgaactgaaacacttttatatatagcggcaagaaaacaacatttagataaagttgttata
cctgcattaaagtcaggtactattgtaatttgtgatagatttatggattcaacgtcagca
tatcagggatatgccagaaacatagggatgactgaaattgatgaagtacaaaacatagtt
ttaggctctacaaaaccagatttaacaattttttttgatattaccccgaatgaagctcat
attagactattaaaaagaaaaagaaaaccagatagattagaaagtgaaaatgctttattt
cacgaagctgtttacgaaggttatcaaatacttatttcagaaaatacagatagaattaaa
gttgtcgactcaagaaaaccaattaatgaggttttgcaacaagtagactttttaattaat
gatgcattaaatcaaagaatgaaaaaaaatgactaa

DBGET integrated database retrieval system