KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10249Help
Entry
HMPREF0833_10249  CDS       T01545                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00010  Glycolysis / Gluconeogenesis
scp00030  Pentose phosphate pathway
scp00051  Fructose and mannose metabolism
scp00052  Galactose metabolism
scp00680  Methane metabolism
scp01100  Metabolic pathways
scp01110  Biosynthesis of secondary metabolites
scp01120  Microbial metabolism in diverse environments
scp01130  Biosynthesis of antibiotics
scp01200  Carbon metabolism
scp01230  Biosynthesis of amino acids
scp03018  RNA degradation
Module
scp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_10249 (pfkA)
   00030 Pentose phosphate pathway
    HMPREF0833_10249 (pfkA)
   00051 Fructose and mannose metabolism
    HMPREF0833_10249 (pfkA)
   00052 Galactose metabolism
    HMPREF0833_10249 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0833_10249 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HMPREF0833_10249 (pfkA)
Enzymes [BR:scp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0833_10249 (pfkA)
Protein phosphatases and associated proteins [BR:scp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0833_10249 (pfkA)
Messenger RNA biogenesis [BR:scp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HMPREF0833_10249 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEH55280
UniProt: F8DFS0
Position
259184..260197
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGKIQPLDRSSVGDI
ISRGGTFLHSARYPEFAQREGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTELGFPAV
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHHRTFVIEVMGRNAGDIALWA
GIASGADEIIIPEEGFKIEDVVESIKEGYAKGRTHNIIILAEGVMSADEFGKALKAAGDE
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKQGIGGVAVGIRNEKMVENPILGK
AEEGALFSLTEDGKIVVNNPHKADLGLAELNRSLSSI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggagatgcccctggtatgaatgctgccatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagttttcggtatctatgatgga
tatgcgggaatggttgctggtaaaattcagccccttgatagatcatctgttggagatatt
atttcccgtggtggtactttccttcattcagcacgttaccctgaattcgcacaacgcgaa
ggtcaattaaaagggatcgagcaattgaagaaacacgggatcgaaggtgttgtcgttatt
ggtggagatggttcttaccatggtgcgatgcgcttgactgaacttggattcccagctgtt
ggtcttcctggtacgatcgacaacgatattgtcggaactgattttacaattggttttgat
actgcagtcacaactgcaatggacgcgatcgataagatccgtgatacttcatctagtcac
caccgtaccttcgttattgaagtgatgggacgtaacgctggagatatcgctctttgggca
gggattgcatctggtgcagatgaaatcatcattcctgaagaaggattcaagatcgaagat
gttgttgagagcatcaaagaaggttacgcaaaaggccgtacccacaacattatcatttta
gctgaaggcgtgatgtctgcagatgaattcggtaaagccttgaaagcggctggtgatgaa
agtgaccttcgtgtgactgaacttggccacatccaacgtggtggttcacctactgcgcgt
gaccgtgttcttgcttcacgtatgggagcacacgctgttaaattgctgaaacaaggaatc
ggtggtgtagccgttggtatccgtaatgaaaaaatggttgaaaacccaatccttggtaaa
gcagaagaaggagccctctttagcttgacagaagatggtaagattgtggtaaacaatcca
cataaagctgatcttggtcttgccgagttgaaccgtagcttgtcttcaatctaa

DBGET integrated database retrieval system