KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10461Help
Entry
HMPREF0833_10461  CDS       T01545                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00670  One carbon pool by folate
scp01100  Metabolic pathways
scp01120  Microbial metabolism in diverse environments
scp01200  Carbon metabolism
Module
scp_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:scp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HMPREF0833_10461 (fhs)
Enzymes [BR:scp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     HMPREF0833_10461 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS T3SchapCesA CbiA DUF719 DUF1002
Motif
Other DBs
NCBI-ProteinID: AEH55492
UniProt: F8DGU6
Position
469489..471216
Genome map
AA seq 575 aa AA seqDB search
MLFSRILGIIDLSNIKESLMKTDIEIAQSIELQPIVDVVKKIGLVDDDLELYGKYKAKLS
FDKIREVEKNPVGKLILVTAINPTPAGEGKSTITIGLADALNKIGKKTMIAIREPSLGPV
MGIKGGAAGGGYAQVLPMEDINLHFTGDMHAITTANNALSALIDNHLHQGNELGIDQRRI
IWKRVVDLNDRALRHVSVGLGGPLNGIPREDGFDITVASEIMAILCLATDIEDLKRRLAN
IVIGYRYDRSPVYVRDLEVEGALALILKDAIKPNLVQTIYGTPAFVHGGPFANIAHGCNS
VLATTTALHLADYTITEAGFGADLGAEKFLDIKTPNLPTSPDAVVIVATLRALKMNGGVT
KDALTEENVEAVRAGFANLKRHVENIRKFGIPAVVAINEFITDTEAEIAALKVLCAEIDV
PVELASVWANGADGGVELAETLVKTIETSPANYTRLYDNNLSVEEKIEKIVTEIYRGTKV
NFEKKAKTQIAQIVKNGWDKLPICMAKTQYSFSDNPNALGAPENFEITIREVVPKLGAGF
IVALTGDVMTMPGLPKRPAALNMDVAADGTAIGLF
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgttattttcgcgaattttaggtataatagatctatcaaatataaaggagtcccttatg
aaaacagatatcgaaattgctcaaagcattgaactccaaccgattgtggacgttgttaag
aagattggtttggtagacgatgatcttgaattgtatggaaaatacaaggcgaaattgagc
tttgataagattcgtgaagttgagaaaaatccagtaggaaaacttatcttagtcactgcg
atcaacccaactccagctggagaagggaaatcaaccatcaccattggtctagcagatgct
ttgaataaaatcggtaaaaaaaccatgattgccattcgcgaaccttctttaggtccagtt
atggggattaaaggtggtgctgctggtggtggttatgcccaagttctaccgatggaagac
atcaaccttcatttcacaggggatatgcatgcgatcacaacggctaataacgctctctca
gcattgattgataatcatttgcaccaaggaaatgagctaggaattgaccaacgtcggatt
atctggaaacgggtagtggacttgaatgaccgcgctcttcgtcatgtttctgttggcctt
ggcggtcctttaaatgggattccgcgtgaagacggttttgatattactgttgcttctgag
atcatggccatcctttgcttggcgacagatattgaagatttgaaacgtcgtttggccaac
attgtaattggttaccgctatgatcgtagtccagtttatgtccgtgatttagaagtagaa
ggggctcttgccttaatcctcaaagatgcgatcaagccaaacttggttcaaaccatctat
ggtacacctgcctttgttcacggtggtccatttgcaaatattgctcatggatgtaactct
gtattagcaacgacgacagctcttcatttagcagattatacgattacagaagctggtttt
ggggctgacctcggtgctgaaaaattcctcgatattaaaactccaaacttgcctacatca
ccagatgcagtcgtaatcgtagcgactctccgtgctcttaagatgaacggtggagtgacc
aaggatgctttgactgaagaaaatgtagaggctgttcgtgctggttttgccaacttgaaa
cgtcacgttgaaaatatccgtaagtttggcattcctgcagtggttgccatcaatgaattt
atcaccgatacagaagcagaaattgctgctttgaaagtattgtgtgctgaaattgatgta
ccagttgagcttgcgagcgtatgggcgaatggtgctgacggtggagttgaacttgctgaa
acgctggtcaagactattgaaacaagtccagctaactacacacgcttgtatgataacaac
ctttctgttgaagaaaaaattgaaaagattgttacagagatttaccgcggtactaaggtg
aattttgagaagaaagccaagacacaaattgcccaaatcgtgaaaaatggatgggataag
ttgccaatctgtatggccaaaacacaatatagcttctccgataatccaaacgccttggga
gctcctgaaaactttgaaatcactattcgtgaagtggttccaaaattgggagcaggcttt
attgtcgctttgactggggatgtcatgaccatgcctggtttaccaaaacgtccagctgct
ttgaatatggatgtggctgctgatggaacagccatcggtttgttctaa

DBGET integrated database retrieval system