KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10803Help
Entry
HMPREF0833_10803  CDS       T01545                                 

Gene name
hYR
Definition
(GenBank) peroxiredoxin HYR1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00480  Glutathione metabolism
scp00590  Arachidonic acid metabolism
scp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    HMPREF0833_10803 (hYR)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HMPREF0833_10803 (hYR)
Enzymes [BR:scp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HMPREF0833_10803 (hYR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEH55834
UniProt: F8DII2
Position
830151..830633
Genome map
AA seq 160 aa AA seqDB search
MTSIYDFSLENQKGEEIPLSHYQGKVLIVVNTATGCGLTPQYQGLQDLYLRYQEKGLEIL
DIPCNQFMGQAPGTAEEINSFCSLNYQTTFPRFAKAKVNGKEALPLYDWLKSQAAGPLGK
RIEWNFAKFVIGRQGQVAQRFSSKTEPAAMEDLIQELLEK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatttatgatttttctttagaaaaccagaaaggggaggagattcccctttct
cactaccaaggtaaggtcctcatcgtggtcaatacagcaacaggctgtggcttgaccccg
caataccaaggactgcaagatctctacctgcgctaccaggaaaaaggacttgaaattcta
gacattccctgtaaccaattcatggggcaggcaccaggaacggcagaagaaatcaatagc
ttctgtagcctcaactaccagaccaccttcccacgattcgctaaagccaaggtcaatggt
aaagaagcccttcctctctatgactggcttaaaagccaagcagctgggccactgggcaaa
cgcatcgaatggaacttcgcaaaatttgtcatcggccgacaaggccaagtcgcccaacgc
ttctcctccaaaacagagccagctgctatggaagacttgatccaagaattgcttgaaaaa
taa

DBGET integrated database retrieval system