KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11089Help
Entry
HMPREF0833_11089  CDS       T01545                                 

Definition
(GenBank) putative chlorophyll synthesis pathway protein BchC
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:scp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF0833_11089
Enzymes [BR:scp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HMPREF0833_11089
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HMPREF0833_11089
    1.1.1.-  
     HMPREF0833_11089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AEH56120
UniProt: F8DJV0
Position
complement(1123040..1124083)
Genome map
AA seq 347 aa AA seqDB search
MATMKAARWHAAKDVRIEEVEVPEVQPHQVKVAVKFTGICGTDLHEYLDGPIFIPTEEHV
YSGQKAPVTLGHEFSGEIVEVGSDVTRVKVGDRVTIEPILAEHNLIGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSALKTGDTAVIFGLGP
IGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGETVVEAIHRLTGGGADV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREASINPNEFAIQEKSLKGIIAYRHIFPK
VLELMEQGYFSAEKLVTKKIKLENIVEEGFIELTQDKSQIKILVQPE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctactatgaaagcagcacgctggcatgcagcaaaagacgttcgtattgaagaggtg
gaagtacctgaagtacaaccacatcaagtaaaggtggcagttaagttcacggggatttgc
gggacagacttgcatgaatatttggacggcccaatcttcattccaacagaagaacatgtt
tattctggtcaaaaagcaccagttactttgggacatgaattctctggtgaaattgtagaa
gtcggaagtgatgtcactcgtgtcaaagttggggatcgtgtaaccatcgaaccaattctt
gcagagcacaacttaattggtgattataaccttgatccaaacttgaacttcgtcggcctc
gctgcagatggtggttttgctaaatattgtgtccttgatggtgatcttgtccatgtgatt
ccagatagcttgagctatgaacaagccgctcttacagaacctgctgctgtagctgtgtat
gcagttcgtcaatctgctttgaaaactggtgatacagctgttatctttggtttaggccca
attggtctcttgatcgttgaagccctccgtgcagcaggagcatcaaaaatctatgcggtt
gaattgtctcctgaacgccaagctaaagcagaagaattgggagcgatcgttgttcgccca
gaagaaggagaaacagtcgtagaagccatccatcgtttgacaggtggtggagcagatgtt
tcttatgaagtcactggggttccagttgttttaggccaagcccttgcagctgttcataaa
gctggggaatgtatggttgtatctatctgggaacgtgaagcgagcatcaatccaaatgaa
ttcgctattcaagaaaaatccctcaaaggaattattgcttaccgtcatatcttccctaaa
gtcttggaattgatggaacaaggttacttctctgctgagaaattggttaccaagaaaatt
aaattggaaaatatcgttgaagaaggatttattgaattaacacaagataaatcccaaatc
aagatcttggttcaacctgaataa

DBGET integrated database retrieval system