KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11667Help
Entry
HMPREF0833_11667  CDS       T01545                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00790  Folate biosynthesis
scp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0833_11667 (folE)
Enzymes [BR:scp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HMPREF0833_11667 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEH56698
UniProt: F8DH02
Position
1791409..1791963
Genome map
AA seq 184 aa AA seqDB search
MDTKKIEEAVKMIIEAVGEDENREGLQETPTRIAKMYQEIFAGLGQTAEEHLSKSFEIID
NNMVVEKDIFFHSMCEHHFLPFYGKVHIAYIPNGRVAGLSKLARTVEVYAKKPQIQERLT
VEIADALMEYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGVLATNKDLKNEAYK
LMGH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaagaaaattgaagaagcagtgaaaatgatcatcgaggcagtcggtgaagat
gagaaccgtgagggccttcaggaaacgccgacccgcattgccaagatgtaccaagaaatc
tttgcgggactagggcagacagcagaagagcacctgtctaaatcatttgaaatcattgat
aacaatatggtggtcgagaaggatatcttcttccattccatgtgtgagcatcacttttta
ccattttatggaaaagtgcacattgcctacattccaaatggccgtgtggctgggctttca
aaactggctcgtacggtcgaggtttatgctaaaaaaccacagattcaggaacgtttgacg
gtagaaatcgcagatgccttgatggaatatcttggagcacaaggagcacttgtctgggta
gaagcagagcatatgtgtatgaacatgcgtggtgtccgtaaacctgggaccgctacagtg
acaactgcagcgcgtggagtgcttgcgacaaataaagacttaaaaaatgaagcctataaa
ctcatgggccactaa

DBGET integrated database retrieval system