KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11895Help
Entry
HMPREF0833_11895  CDS       T01545                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00010  Glycolysis / Gluconeogenesis
scp00260  Glycine, serine and threonine metabolism
scp00680  Methane metabolism
scp01100  Metabolic pathways
scp01110  Biosynthesis of secondary metabolites
scp01120  Microbial metabolism in diverse environments
scp01130  Biosynthesis of antibiotics
scp01200  Carbon metabolism
scp01230  Biosynthesis of amino acids
Module
scp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_11895
  Energy metabolism
   00680 Methane metabolism
    HMPREF0833_11895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0833_11895
Enzymes [BR:scp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0833_11895
Membrane trafficking [BR:scp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HMPREF0833_11895
Exosome [BR:scp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0833_11895
  Exosomal proteins of melanoma cells
   HMPREF0833_11895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEH56926
UniProt: F8DI67
Position
2018413..2018967
Genome map
AA seq 184 aa AA seqDB search
MNNSYILLRHAHSRFSSDDFNRTLSEKGFSSLNQLDFLNSFNIGYYFSSPYKRAFETINS
SPIQFDKIVLDNRLRERKLSSRFIEDTEFEKTIQYLWQNPDKSLIGGESNREALNRILDL
FEDLEERYSDKTILLSSHGNLLGILINHFDSSFDYKKWGQMTFPDCFLVDKDKSVKRIMK
VTSR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcttatattttacttagacatgctcattcaagattttcaagtgatgatttt
aatagaactttgtcagaaaaaggattttcatctcttaatcagttagattttttgaattct
tttaatattggttattatttttctagtccttataaacgagcatttgaaacgattaatagc
tcgccaattcaatttgataaaatagttcttgataatcggttacgagagcgaaaattatcc
tcaagatttattgaagatactgagtttgaaaaaacaattcaatatttatggcaaaatcca
gataaatctcttattggaggcgagtccaatcgagaagcattaaatagaattttagattta
tttgaggacttggaagaaaggtattcagataaaaccattttactgagttctcatggaaat
ttgctaggaatcttaatcaatcattttgattcaagttttgattataaaaaatggggacag
atgacttttccagattgctttctagttgacaaagataagagtgtgaaaagaattatgaaa
gttacatctaggtaa

DBGET integrated database retrieval system