KEGG   Stanieria cyanosphaera: Sta7437_3335Help
Entry
Sta7437_3335      CDS       T02406                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00471  D-Glutamine and D-glutamate metabolism
scs00550  Peptidoglycan biosynthesis
scs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sta7437_3335
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sta7437_3335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:scs01011]
    Sta7437_3335
Enzymes [BR:scs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Sta7437_3335
Peptidoglycan biosynthesis and degradation proteins [BR:scs01011]
 Precursor biosynthesis
  Amino acid ligase
   Sta7437_3335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C TrkA_N NAD_binding_8 IlvN XdhC_C
Motif
Other DBs
NCBI-ProteinID: AFZ36841
UniProt: K9XXL1
Position
complement(3775886..3777274)
Genome map
AA seq 462 aa AA seqDB search
MPKAQIIGLGRSGIAAAKLLSQDGWEVTIADAASEENLISRSNRSEFQALKAKLAQEKIK
LQLGQPQLLNSADLPKLLVVSPGVPWDLPPLIEAREKKIDTIGEIELAWRYLKSVPWVGI
TGTNGKTTTTALIAAIFQAAGLNAPACGNIGYAACELALEKTNDQSFDWIVAELSSYQIE
SSEQLSPQIGVWTTFTPDHLSRHKTLENYYKIKASLLHRSRHKIFNGDDPYLRKVGEEQW
QNAYWTSIKGKDRLICSTERGVYLEDGWVVAFGELILPISLFKMPGVHNQQNLLMAVAAT
KLAGIDQGAIASAIATFSGVPHRLEYIRTFKGIDFINDSKATNYDAAEVGLASVDAPVIL
IAGGEAKEGEDLAWIEKIKQKAATVLLIGEAAPTFAQRLTECGYNSFEIVETMANAVIRS
VELAKQKNAEVVLLSPACASFDQYRSFEHRGDDFRQLCQELS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagctcaaattattggattaggaagatcgggaattgctgctgctaaattactc
agtcaagatgggtgggaagttacaattgctgatgctgctagtgaagaaaatctgatttct
cgctctaatcgaagcgaatttcaagccttaaaagcaaaattggcacaagagaagattaaa
cttcaactaggtcaacctcaattgctcaattcggcagatttacccaaattgctagttgtt
agtcctggcgttccttgggatctccctccattgattgaggcaagagaaaaaaaaattgac
acaattggagaaattgaactcgcttggcgttatctcaaatcagtaccttgggtaggaatt
acaggtactaacggcaaaactacgacaacagctttaattgcagcaatttttcaagctgcg
ggattgaatgcgcctgcttgtggcaatattggttatgcagcctgtgaattagctctagaa
aaaactaatgatcaatcttttgattggattgtcgctgaattgagtagttatcaaattgaa
tcatccgagcaactttcaccacaaataggagtttggactacttttactcccgatcatctc
agtcgtcacaaaaccctagaaaattattacaagatcaaagcttctttgctacatcgtagt
cgccacaaaatttttaatggagatgatccctatttacgtaaagtaggagaagaacaatgg
caaaatgcttattggacaagtattaaaggcaaagaccgcttaatttgttcgaccgaacga
ggggtttatcttgaagatggatgggtagtagctttcggagagttaattttaccaatctcg
ttatttaagatgcctggagtacataatcaacaaaacttactaatggcagtagcagcaact
aaattagctggaattgatcaaggcgcgatcgcatcagctattgctactttttctggtgta
cctcatcgtttggagtatattcgcacttttaagggaattgattttattaatgatagtaaa
gcaactaattacgatgcagcagaagtagggttagcttctgtagatgcgccagtgatttta
attgcagggggagaggcgaaagaaggagaggatttagcttggattgagaaaatcaaacaa
aaagcagcaactgttttattaattggagaagctgcacctacttttgctcaaagattaact
gaatgtggttataattcctttgaaattgtcgaaacaatggcaaatgctgtaattagaagt
gtagaattagccaaacaaaaaaacgctgaagtagttttattgtctcctgcctgtgctagt
ttcgatcaatatcgcagttttgaacatcgaggcgatgattttcgtcaactttgtcaagag
ttatcataa

DBGET integrated database retrieval system