KEGG   Stanieria cyanosphaera: Sta7437_3502Help
Entry
Sta7437_3502      CDS       T02406                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00010  Glycolysis / Gluconeogenesis
scs00071  Fatty acid degradation
scs00350  Tyrosine metabolism
scs00625  Chloroalkane and chloroalkene degradation
scs00626  Naphthalene degradation
scs01100  Metabolic pathways
scs01110  Biosynthesis of secondary metabolites
scs01120  Microbial metabolism in diverse environments
scs01130  Biosynthesis of antibiotics
scs01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sta7437_3502
  Lipid metabolism
   00071 Fatty acid degradation
    Sta7437_3502
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sta7437_3502
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sta7437_3502
   00626 Naphthalene degradation
    Sta7437_3502
Enzymes [BR:scs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sta7437_3502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFZ37000
UniProt: K9XWM9
Position
complement(3952822..3953808)
Genome map
AA seq 328 aa AA seqDB search
MRAMILNEPGQSLRKVELPVPTPQPEQVLLKVRACGVCRTDLHIVDGELPHPKLPLILGH
QIVGIVEQVGAKVSKFIPGNRVGVPWLGSTCNCCRYCLSGRENLCDRAQFTGYNLDGGYA
EYVVANENFCFFIPNDYPDLQAAPLLCAGLIGYRSYKMTGDAKRVGFYGFGAAAHILLQV
ACYQDKQVYAFTRRGDTQGQQFALNLGAVWAGSSEELPPDELDAAIIFAPVGNLVPAALH
AVAKGGVVVCAGIHMSDIPSFPYEILWSERVLRSVANLTRQDGEEFLTLAPQIPIHTEVT
PFALSKANQALEALRSGKINGAAVLVVD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctatgattcttaacgaaccaggtcaatctttacgaaaagttgagttacctgtg
cctactcctcaaccagaacaagttttattaaaagttcgagcttgtggagtttgtcgtact
gatttacatatagtagatggcgaattacctcaccctaagttacctctgattttaggacat
cagattgttggaatagtagaacaagtaggagcaaaagtcagcaaatttattcctggcaac
cgtgtcggtgtaccttggttaggttctacctgtaactgttgtcgttattgtttatctgga
agagagaatctttgcgaccgcgctcaattcacaggctacaatctagatggtggttatgct
gaatatgtcgtagctaacgaaaatttttgtttctttattcccaatgactatccagattta
caagcagcccctctactatgtgctggtttaatcggttatcgctcctacaaaatgactggg
gatgcaaaacgtgtgggtttttatggttttggtgctgctgctcacattttgctccaggta
gcttgttatcaagataagcaagtttatgcttttactcgtcggggcgatactcaaggacaa
caatttgctcttaatttaggtgcagtttgggctggtagttctgaggaattaccacctgat
gaattggatgcagccattatttttgctcctgttggtaatttagtaccagcagccttacac
gcagtagctaaaggaggtgtggttgtctgcgccggcatccatatgagcgatatcccttcc
tttccctatgaaattttatggtcagaacgagttttacgctcagttgctaacctcactcgc
caagatggagaagagtttctcactctagcccctcagattcccattcataccgaagtaact
ccttttgctctaagtaaagctaatcaagctttagaagctttacgctcaggtaaaattaat
ggagcagcggtgttagttgtcgattaa

DBGET integrated database retrieval system