KEGG   Stanieria cyanosphaera: Sta7437_4706Help
Entry
Sta7437_4706      CDS       T02406                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:scs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    Sta7437_4706
Enzymes [BR:scs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     Sta7437_4706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N F420_oxidored Epimerase Sacchrp_dh_NADP GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: AFZ38155
UniProt: K9XZZ1
Position
pSTA7437.01:complement(214413..215210)
Genome map
AA seq 265 aa AA seqDB search
MTQFDAFADFRMNNHHVIITGGAQNIGAGIAKTLASAGANVMIADLQGDKAKKTAANIEG
ETSSHCRGMACDVTNSEDINAVVAATVEAFGGISTLINNVGWGARHDDPTAISDQAFIDS
YKLNTISAYRMSMACLPHLLKAENPSITNSGSFSSAVPAYDILAYGTSKAALNQMMISIA
HMLAQKVRVNSILIGTVMTAGYSDAGIDPTVQEKLLHPDNLTGRTGKPRDIANAMLWLCS
PAGSWVSGQIIKVHGGGSVVRLFDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatttgatgcttttgcagatttccgcatgaataaccatcatgtcattattacg
ggtggcgcacagaatatcggtgcaggaatagccaagacgcttgccagtgctggagcgaac
gtgatgattgccgatctccaaggcgataaagccaagaaaacggcagcaaatatcgaagga
gaaacaagtagtcattgccgtggcatggcttgcgacgtgacgaactccgaggacataaac
gcggtggtggctgcaactgtagaggcgttcggcggaatatcgacgctaatcaataatgtg
ggttggggcgcacgccatgacgatcccacagcgatttccgaccaagcgtttattgattcc
tacaagctcaacacaatcagcgcctaccgcatgtctatggcgtgcctacctcacttactc
aaggcagagaatcccagtattaccaattctgggtcattttcatcagccgtgcctgcttat
gacatcctggcttatggcacatctaaggcagccctaaaccagatgatgatttcgatcgca
cacatgctggctcaaaaggttcgcgtgaactctatcctcattggcactgtaatgacggct
ggctatagtgatgctgggatcgatcctaccgtgcaggaaaagttattgcatcccgacaat
ctcactggtagaacaggtaaacctagagatattgctaacgcgatgctttggttatgttcg
ccagcgggtagttgggttagcggtcagataatcaaagttcacggcggtggctctgtcgtc
cgcctcttcgacagttga

DBGET integrated database retrieval system