KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_1838Help
Entry
SCAT_1838         CDS       T01646                                 

Definition
(GenBank) Exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sct00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SCAT_1838
Enzymes [BR:sct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SCAT_1838
DNA repair and recombination proteins [BR:sct03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SCAT_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD AAA_22 PIF1 PhoH HHH_2 AAA_16 UvrD_C AAA_10 HTH_IclR AAA TrwB_AAD_bind DEAD DAP3
Motif
Other DBs
NCBI-ProteinID: CCB74558
UniProt: F8JZP9
Position
complement(1940341..1942629)
Genome map
AA seq 762 aa AA seqDB search
MDPRPPSQPRPQPGKQPQRPPGQGEFRPAVLEAVLERITYANKENGYTVARVDTGRGSGD
LLTVVGALLGAQPGESLRMEGRWGSHPQYGKQFTVENYTTVLPATIQGIRRYLGSGLIKG
VGPRIAERIVSHFGTDTLEVIEQDPARLIEVPGLGPKRTRKIAAAWEEQKAIKEVMVFLQ
GVGVSTSIAVRIYKQYGDASISVVRNEPYRLAADVWGIGFLTADRIAQAVGIPHDSPERV
KAGLQYALSQATDNGNCFLPEERLIADAVKLLQVDTGLVIDCLGELVEAEGVVRERVPDP
DGGDAIRAVYLVPFHRAEISLAGQVLRLLRGPEDRMPAFRDVAWDKALAWLRDRTGAELA
PEQEQAVRLALTEKVAVLTGGPGCGKSFTVKSVVTLARAKKAKVVLAAPTGRAAKRLAEL
TGAEASTVHRLLELKPGGDAAYDRDRPLDADLVVVDEASMLDLILANKLVKAVPPGAHLL
FVGDVDQLPSVGAGEVLRDLLAEGSPVPAVRLTRIFRQAQQSGVVTNAHRINSGLPPVTQ
GLADFFLFPEEDTEEAGRLTVDVVARRIPAKFGLDPRRDVQVLAPMHRGPAGAGVLNGLL
QQAVTPGRPDLPERRFGGRVFRVGDKVTQIRNNYDKGANGVFNGTVGVVTALDNDEHRLT
VRTDEDEEVGYDFDELDELAHAYAVTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVT
RAKRLVVLVGSRRALAQAVRTVSAGRRFTALDHRLRGAVRES
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggatccgcgaccgccgtcacaaccccgcccgcagccggggaagcagccgcaacggccc
ccgggccagggcgagttccgccccgccgtcctggaggccgtgctggaacgcatcacgtac
gccaacaaggagaacggctacacggtggcccgcgtcgacaccggccgcggctcgggcgac
ctgctcaccgtcgtcggcgccctgctcggcgcgcagcccggcgaatccctgcgcatggag
ggccgctggggctcccacccgcagtacggcaagcagttcaccgtggagaactacaccacc
gtcctgcccgccaccatccagggcatccgccgctacctgggctccgggctgatcaagggg
gtcggcccgcgcatcgccgagcgcatcgtctcccacttcggcaccgacaccctggaggtg
atcgagcaggacccggcccgcctcatcgaggtccccggcctcggccccaaacgcaccagg
aagatcgccgccgcctgggaggagcagaaggcgatcaaggaagtgatggtcttcctccag
ggcgtgggcgtctccacctcgatcgcggtgcgcatctacaagcagtacggcgacgcctcg
atctccgtggtgcgcaacgagccctaccgcctcgccgccgacgtgtggggcatcggcttc
ctcaccgccgaccgcatcgcccaggccgtcggcataccgcacgacagcccggagcgggtc
aaggccgggctccagtacgcgctctcccaggccaccgacaacggcaactgcttcctgccc
gaggaacgcctcatcgccgacgccgtcaaactcctccaggtcgacaccgggctggtcatc
gactgcctgggggagctggtcgaggccgagggggtggtccgggagcgggtgccggatccg
gacggcggtgacgcgatccgcgcggtctacctggtgcccttccaccgcgccgagatatcg
ctggccggccaggtgctgcggctgctgcgcggcccggaggaccggatgcccgccttccgc
gacgtggcctgggacaaggcgctggcctggctgcgcgaccggaccggcgccgagctcgcc
ccggagcaggagcaggcggtgcggctggcgctcaccgagaaggtcgcggtgctcaccggc
ggccccggctgcggcaagtcgttcaccgtgaaatcggtggtgaccctggcccgggccaag
aaggccaaggtggtgctggccgccccgaccgggcgggccgccaagcggctggccgagctg
accggggcggaggcgtccaccgtccaccggctgctggagctcaagcccggcggtgacgcc
gcctacgaccgcgaccgcccgctcgacgccgacctggtcgtggtcgacgaggcgtccatg
ctcgacctgatcctcgccaacaagctggtcaaggcggtgccgccgggggcccacctgctc
ttcgtgggcgatgtcgaccagctgccgagcgtgggcgcgggagaggtgctgcgcgacctg
ctggccgagggcagtccggtgcccgcggtgcggctcacccggatcttccgccaggcccag
cagtccggggtggtcaccaacgcccaccggatcaactccgggctgccgccggtcacccag
gggctcgccgacttcttcctcttccccgaggaggacaccgaggaggccgggcggctcacg
gtggacgtggtggcgcggcgcatcccggccaagttcggcctcgacccgcgccgcgacgtc
caggtgctcgccccgatgcaccgcggaccggccggcgccggggtgctcaacgggctcctc
cagcaggcggtcacccccggccgccccgacctgcccgagcgccgcttcggcggccgggtc
ttccgggtcggcgacaaggtcacccagatccgcaacaactacgacaaaggcgccaacggt
gtcttcaacggcacggtcggcgtggtcaccgcgctcgacaacgacgaacaccggctcacc
gtgcgcaccgacgaggacgaggaggtcggctacgacttcgacgaactggacgaactggca
catgcctacgcggtgaccatccaccgttcccagggcagcgagtatcccgccgtggtgatc
ccggtcaccacgggcgcctggatgatgctccagcgcaatctgctctatacggccgtgacc
cgggcaaagcggttggtggttctggtcggctcacggcgggcactcgcacaggcggtacgc
accgtttccgcaggccgacgcttcaccgcactcgatcaccggctgcgcggcgcggtgcgg
gagagctga

DBGET integrated database retrieval system