KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_2449Help
Entry
SCAT_2449         CDS       T01646                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00260  Glycine, serine and threonine metabolism
sct00750  Vitamin B6 metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01230  Biosynthesis of amino acids
Module
sct_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_2449
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCAT_2449
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCAT_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Death_2
Motif
Other DBs
NCBI-ProteinID: CCB75160
UniProt: F8K030
Position
complement(2586944..2588224)
Genome map
AA seq 426 aa AA seqDB search
MAVETVAPATRSTDFGNAVALSCRECGERVPLGPVFACAVCFGPLEVAYEFPADPEGLRA
RIEAGPHSIWRYAPLLPVPADVATKPNLDPGFTKLVKADRLARELGVTGGLHIKDDSGNP
THSFKDRVVAIAVEAARNFGLTTLSCSSTGNLAGAVGAAAVRAGFKSCVFIPHDLESGKV
VMAAVYGGDLVGIEGTYDDVNRFCSELIGDPIGEGWGFTNVNLRPYYGEGSKTLAYEICE
QLGWRLPDNIVIPIASGSQLTKIDKGLQELIKLGLVEEKPYRIYGAQAAGCNPVAAAFKA
GHDVVRPVKPDTIAKSLAIGNPADGPYVLDIARRTGGAVEEVDDEQVVDAIKLLARTEGI
FAETAGGVTIGVLKKLIETGQLDPAAETVAINTGDGLKTLDAVAPTTGPTAIIRPTLDSF
REAGLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaaaccgtcgcacccgccacccgctcgaccgacttcggcaacgccgtagcc
ttgtcctgccgcgagtgcggcgagcgcgtcccgctcggaccggtcttcgcctgcgcggtc
tgtttcggaccgctggaagtggcgtacgagttccccgccgaccccgaggggctgcgggcg
cgcatcgaggccggaccgcacagcatctggcgctacgccccgctgctgcccgtcccggcc
gacgtggccaccaaacccaacctggaccccggcttcaccaagctggtcaaggccgaccgg
ctcgcccgcgaactcggcgtcaccggcggcctgcacatcaaggacgactccggcaacccc
acccactcgttcaaggaccgggtggtcgccatcgccgtcgaggccgcccgcaacttcggc
ctcaccacgctctcctgctcctccaccggcaacctggccggcgccgtcggggccgccgcg
gtgcgcgcgggcttcaagtcctgcgtcttcatcccgcacgacctggagtccggcaaggtc
gtcatggccgcggtctacggcggcgacctggtcggcatcgagggcacctacgacgacgtc
aaccgcttctgcagcgagctgatcggcgacccgatcggcgagggctggggcttcaccaac
gtcaacctgcgcccctactacggcgagggctccaagacgctggcgtacgagatctgcgag
cagctcggctggcggctgccggacaacatcgtcatccccatcgcctccggctcccagctc
accaagatcgacaaggggctccaggagctgatcaagctgggcctggtcgaggagaagccc
taccggatctacggcgcccaggccgccgggtgcaacccggtggccgccgccttcaaggcc
ggccacgacgtggtgcggccggtcaagccggacaccatcgccaagtcgctggccatcggc
aacccggcggacggcccctacgtgctcgacatcgcccggcgcaccggcggcgcggtcgag
gaggtcgacgacgagcaggtggtcgacgccatcaagctgctcgcccgcaccgagggcatc
ttcgccgagaccgccggcggcgtgaccatcggcgtgctcaagaagctgatcgagaccggt
cagctcgacccggccgccgagaccgtcgccatcaacaccggcgacggactgaagaccctg
gacgcggtggcccccaccaccggtcccaccgcgatcatccgccccacccttgactcgttc
cgagaggctggcctcgcatga

DBGET integrated database retrieval system