KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_3673Help
Entry
SCAT_3673         CDS       T01646                                 

Definition
(GenBank) Oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00984  Steroid degradation
sct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SCAT_3673
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SCAT_3673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 GIDA HI0933_like Fer4_9 FAD_oxidored Fer4_21 OpcA_G6PD_assem Pyr_redox Fer4_6 Thi4 Lycopene_cycl Fer4
Motif
Other DBs
NCBI-ProteinID: CCB76369
UniProt: F8JZF1
Position
3946272..3948128
Genome map
AA seq 618 aa AA seqDB search
MSEEPHGQGPAAAGEDPSHQARPDDGHDGDDRYDYDVIVVGSGFGGSVAALRLTEKGYRV
GVLEAGRRFARGTLPKNSWRVRDYLWAPALGLYGIQRIHLLGNVLVLAGAGVGGGSLNYA
NTLYVPPEPFFTDRQWGEITDWREELAPYYDQARRMLGVRLNPTMTPSDVHLKAAAERMG
VGETFHLAPVGVFFGDGEDADGTVTARPGEEVPDPYFGGAGPARRACVQCGECMTGCRHG
AKNTLTENYLYLAERAGAVIHPMTTVVGVTEDGSGGHLVATVPTDRRRGTRPSVLRARQV
VLAAGTYGTQTLLHAMRDRGDLPRLSPRLGELTRTNSEALVGAQTDDRRYRAAHGEPRAD
FTRGVAITSSIHPNDTTHIEPVRYGKGSNAMGALSVLQVPYGGRAPRWAQFLAHSAKHPW
LALRSLSNRRWSERTIIGLVMQTADNSLTTYRRRKGPGKGLLTARQGHGAPNPTHIPEGA
EAARVLAEEINGFPGSSIGEIADIPMTAHFLGGCPIGADPDHGVIDPYHRLHGHPGIHVV
DGSAVSANLGVNPSLTITAQAERAMALWPNKGDHDPRPAQGTPYQRVAPVTPRRPAVPKE
AFAALVLPVPKVPARPEG
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaggaaccgcacgggcaggggccggccgccgccggcgaggacccgagccatcag
gcgcgccccgacgacggccacgacggggacgaccgctacgactacgacgtgatcgtcgtc
ggctccgggttcggcgggtcggtcgccgcgctgcggctgaccgagaaggggtaccgggtc
ggggtgctggaggccggccgccggttcgcccgcggaacgctgccgaagaactcctggcgg
gtgcgcgactacctgtgggcgcccgccctcgggctctacggcatccagcggatccacctg
ctgggcaacgtcctggtgctggccggcgccggggtgggcggcggctcgctcaactacgcc
aacaccctctacgtcccgccggaaccgttcttcaccgaccgccagtggggggagatcacc
gactggcgcgaggagttggcgccctactacgaccaggccagacggatgctgggggtgcgg
ctcaacccgacgatgaccccttccgacgtccatctgaaggcggcggccgagcggatgggg
gtgggcgaaacgttccatctggcgccggtcggggtcttcttcggcgacggcgaggacgcc
gacggcacggtgaccgcccgccccggcgaggaggtgcccgacccctacttcggcggcgcg
ggaccggcccggcgcgcctgcgtccagtgcggcgagtgcatgaccggctgccgccacggc
gccaagaacacgctcaccgagaactacctgtacctcgccgagcgggccggcgccgtcatc
cacccgatgaccaccgtcgtcggggtcaccgaggacggctccggcggccatctggtggcc
accgtccccaccgaccggcggcgcggcacccggcccagcgtgctgcgggcccgtcaggtc
gtcctcgcggccggcacctacggcacccagacgctgctgcacgccatgcgcgaccggggc
gacctgccgcgcctgtcgccccggctcggcgagctgacccgcaccaactccgaggcgctg
gtgggcgcccagaccgacgaccgccgctaccgcgcggcgcacggcgagccccgggccgac
ttcacccggggcgtcgccatcacctcctccatccaccccaacgacaccacgcacatcgag
ccggtccgctacggcaagggctccaacgccatgggcgcgctctccgtgctccaggtcccg
tacggcggacgggcgccgcgctgggcgcagttcctcgcccacagcgccaaacacccctgg
ctggcgctgcgttcactgtccaaccggcgctggtcggaacggaccatcatcggcctggtg
atgcagaccgccgacaactcgctgaccacgtaccgccggcgcaagggccccggcaaggga
cttctgacggcacgtcagggacatggggcgcccaaccccacccacatacccgagggcgcc
gaggcggcccgggtgctcgccgaggagatcaacggcttccccggcagcagcatcggcgag
atcgcggacatccccatgaccgcccacttcctcggcggctgccccatcggcgccgacccc
gaccacggcgtcatcgacccctaccaccggctccacggccaccccggcatccacgtggtg
gacggctccgcggtctccgccaacctcggcgtcaacccctccctgaccatcacggcccag
gcggaacgggcgatggcgctgtggcccaacaagggcgaccacgacccccgccccgcccag
ggcaccccctaccagcgcgtcgccccggtgaccccgcgccgccccgcggtgccgaaggag
gcgttcgccgcgctggtcctgccggtccccaaggtgccggcgcggccggaggggtga

DBGET integrated database retrieval system