KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_3702Help
Entry
SCAT_3702         CDS       T01646                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase (beta subunit)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00020  Citrate cycle (TCA cycle)
sct00640  Propanoate metabolism
sct00660  C5-Branched dibasic acid metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01200  Carbon metabolism
Module
sct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAT_3702 (sucC)
   00640 Propanoate metabolism
    SCAT_3702 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SCAT_3702 (sucC)
Enzymes [BR:sct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCAT_3702 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 CbiG_N
Motif
Other DBs
NCBI-ProteinID: CCB76398
UniProt: F8K078
Position
3979009..3980181
Genome map
AA seq 390 aa AA seqDB search
MDLFEYQARDLFAKHDVPVLSGEVIDTPEAAREVAERLGGRVVVKAQVKTGGRGKAGGVK
LADGPDDAVEKAGAILGMDIKGHTVHKVMLAQTADIVDEYYVSFLLDRANRTFLAMASVE
GGMEIEEVAATKPEALAKVPVDAKEGVTDAKAREIVEAAKFPAEVADQVAEVLKKLWTVF
IKEDALLVEVNPLAKTGDGTVLAIDGKVSLDANAAFRQPDHAELEDKASANPLEAAAKAK
GLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGNVKPANFLDIGGGASAEVMANGLE
IILGDPAVKSVFVNVFGGITACDAVANGIVQALELLKSKGEDVNKPLVVRLDGNNAELGR
KILTDANHPLVQQVDTMDDAADRAAELAAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaagcgagggatctcttcgccaagcacgatgtaccggtgctg
agcggtgaagtcatcgacacgccggaggccgcgcgcgaggttgccgagcgtctcggcggc
cgtgtggtcgtcaaggcgcaggtcaagaccggtggccgcggcaaggccggcggcgtgaag
ctggccgacggcccggacgacgcggtggagaaggccggcgccatcctgggcatggacatc
aagggccacacggtccacaaggtgatgctggcccagaccgcggacatcgtggacgagtac
tacgtctcgttcctgctggaccgtgccaaccggacgttcctcgccatggcctccgtcgag
ggcggcatggagatcgaggaggtggccgccaccaagccggaggcgctcgccaaggtcccg
gtggacgccaaggagggcgtgaccgacgccaaggcccgcgagatcgtcgaggccgccaag
ttcccggccgaggtcgccgaccaggtcgccgaggtcctcaagaagctgtggaccgtcttc
atcaaggaagacgccctgctggtcgaggtcaacccgctggcgaagaccggtgacggcacg
gtgctggcgatcgacggcaaggtgtcgctggacgccaacgccgccttccggcagccggac
cacgccgagctggaggacaaggcttccgccaacccgctggaggccgccgccaaggccaag
ggcctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggcctg
gtcatgtcgaccctggacgtcgtcgcctacgccggcgagaagcacggcaacgtcaagccg
gccaacttcctggacatcggcggcggcgcctccgccgaggtgatggccaacggtctggag
atcatcctgggcgacccggccgtcaagtcggtcttcgtcaacgtcttcggcggcatcacc
gcgtgcgacgcggtcgccaacggcatcgtccaggccctggagctgctcaagtccaagggc
gaggacgtcaacaagccgctggtcgtgcgtctggacggcaacaacgccgagctgggccgc
aagatcctcaccgacgccaaccacccgctggtgcagcaggtggacaccatggatgacgcg
gcggaccgcgccgccgagctggctgctaagtaa

DBGET integrated database retrieval system